spacer

EBI Dbfetch

ID   AY621107; SV 1; linear; genomic DNA; STD; HUM; 1861 BP.
XX
AC   AY621107;
XX
DT   27-MAY-2004 (Rel. 80, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4201 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1861
RX   DOI; 10.1016/j.humimm.2011.10.013.
RX   PUBMED; 22074999.
RA   Paximadis M., Mathebula T.Y., Gentle N.L., Vardas E., Colvin M., Gray C.M.,
RA   Tiemessen C.T., Puren A.;
RT   "Human leukocyte antigen class I (A, B, C) and II (DRB1) diversity in the
RT   black and Caucasian South African population";
RL   Hum. Immunol. 73(1):80-92(2012).
XX
RN   [2]
RP   1-1861
RA   Puren A.J., Paximadis M., Mathebula T.Y.;
RT   "Distribution of HLA class I and II alleles in the South African population
RT   and its impact on the design of an epitope-based HIV-1 vaccine";
RL   Unpublished.
XX
RN   [3]
RP   1-1861
RA   Puren A.J., Paximadis M.;
RT   ;
RL   Submitted (10-MAY-2004) to the INSDC.
RL   AIDS Unit, National Institute for Communicable Diseases, 1 Modderfontein
RL   Rd., Sandringham, Johannesburg, Gauteng 2131, South Africa
XX
DR   MD5; 3e08e1f97a05fdc7ea507073051343d9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1861
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1861
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201 variant"
FT   mRNA            join(<129..398,645..920,1493..>1768)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<129..398,645..920,1493..>1768)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6IV50"
FT                   /db_xref="IMGT/HLA:B*42:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IV50"
FT                   /protein_id="AAT35594.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTC
FT                   VEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            129..398
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201 variant"
FT                   /number=2
FT   exon            645..920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201 variant"
FT                   /number=3
FT   exon            1493..1768
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4201 variant"
FT                   /number=4
XX
SQ   Sequence 1861 BP; 358 A; 576 C; 607 G; 320 T; 0 other;
     gtgagtgcgg gtcgggaggg aaatggcctc tgccgggagg agcgagggga ccgcaggcgg        60
     gggcgcagga cctgaggagc cgcgccggga ggagggtcgg gcgggtctca gcccctcctc       120
     acccccaggc tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg       180
     ggagccccgc ttcatctcag tgggctacgt ggacgacacc cagttcgtga ggttcgacag       240
     cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg aggggccgga       300
     gtattgggac cggaacacac agatctacaa ggcccaggca cagactgacc gagagagcct       360
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       420
     gcaggtcacg actccccatc ccccacggac ggcccgggtc gccccgagtc tccgggtccg       480
     agatccgcct ccctgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       540
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       600
     ggcggggctc ggggggacgg ggctgaccgc ggggccgggg ccagggtctc acaccctcca       660
     gagcatgtac ggctgcgacg tggggccgga cgggcgcctc ctccgcgggc ataaccagtt       720
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctcct ggaccgcggc       780
     ggacaccgcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagga       840
     cagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa       900
     ggacacgctg gagcgcgcgg gtaccagggg cagtggggag ccttccccat ctcctatagg       960
     tcgccgggga tggcctccca cgagaagagg aggaaaatgg gatcagcgct agaatgtcgc      1020
     cctcccttga atggagaatg gcatgagttt tcctgagttt cctctgaggg ccccctcttc      1080
     tctctagaca attaagggat gacgtctctg aggaaatgga ggggaagaca gtccctagaa      1140
     tactgatcag gggtcccctt tgacccctgc agcagccttg ggaaccgtga cttttcctct      1200
     caggccttgt tctctgcctc acactcagtg tgtttggggc tctgattcca gcacttctga      1260
     gtcactttac ctccactcag atcaggagca gaagtccctg ttccccgctc agagactcga      1320
     actttccaat gaataggaga ttatcccagg tgcctgcatc cgctggtgtc tgggttctgt      1380
     gccccttccc caccccaggt gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag      1440
     ggtgtgccat gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca      1500
     aagacacacg tgacccacca ccccatctct gaccatgagg ccaccctgag gtgctgggcc      1560
     ctgggcttct accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact      1620
     caggacactg agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca      1680
     gctgtggtgg tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg      1740
     ctgccgaagc ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc      1800
     tcagggaaag caggagccct tcagcagggt cagggcccct catcttcccc tcctttccca      1860
     g                                                                      1861
//


spacer
spacer