Dbfetch

ID   AY619997; SV 1; linear; genomic DNA; STD; HUM; 1878 BP.
XX
AC   AY619997;
XX
DT   27-MAY-2004 (Rel. 80, Created)
DT   12-DEC-2012 (Rel. 115, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4501 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1878
RX   DOI; 10.1016/j.humimm.2011.10.013.
RX   PUBMED; 22074999.
RA   Paximadis M., Mathebula T.Y., Gentle N.L., Vardas E., Colvin M., Gray C.M.,
RA   Tiemessen C.T., Puren A.;
RT   "Human leukocyte antigen class I (A, B, C) and II (DRB1) diversity in the
RT   black and Caucasian South African population";
RL   Hum. Immunol. 73(1):80-92(2012).
XX
RN   [2]
RP   1-1878
RA   Puren A.J., Paximadis M., Mathebula T.Y.;
RT   "Distribution of HLA class I and II alleles in the South African population
RT   and its impact on the design of an epitope-based HIV-1 vaccine";
RL   Unpublished.
XX
RN   [3]
RP   1-1878
RA   Puren A.J., Paximadis M.;
RT   ;
RL   Submitted (07-MAY-2004) to the INSDC.
RL   AIDS Unit, National Institute for Communicable Diseases, 1 Modderfontein
RL   Rd., Sandringham, Johannesburg, Gauteng 2131, South Africa
XX
DR   MD5; 715795b265b745be0e111f4885d3d74b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1878
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1878
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501 variant"
FT   mRNA            join(<129..398,649..924,1499..>1774)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<129..398,649..924,1499..>1774)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*45:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IVJ2"
FT                   /protein_id="AAT35593.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGYNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VESLRRYLENGKETLQRADPPKTHVTHHPISDREATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            129..398
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501 variant"
FT                   /number=2
FT   exon            649..924
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501 variant"
FT                   /number=3
FT   exon            1499..1774
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4501 variant"
FT                   /number=4
XX
SQ   Sequence 1878 BP; 359 A; 578 C; 615 G; 326 T; 0 other;
     gtgagtgcgg gtcggcaggg aaatggcctc tgtggggagg agcgagggga ccgcaggcgg        60
     gggcgcagga cccggggagc cgcgccggga ggagggtcgg gcgggtctca gcccctcctc       120
     gcccccaggc tcccactcca tgaggtattt ccacaccgcc atgtcccggc ccggccgcgg       180
     ggagccccgc ttcatcaccg tgggctacgt ggacgacacg ctgttcgtga ggttcgacag       240
     cgacgccacg agtccgagga aggagccgcg ggcgccatgg atagagcagg aggggccgga       300
     gtattgggac cgggagacac agatctccaa gaccaacaca cagacttacc gagagagcct       360
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       420
     gcaggtcacg actccccatc ccccacgtac ggcccgggtc gccccgagtc tccgggtccg       480
     agatccgccc ccctgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       540
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       600
     ggcggggcgg ggctcggggg acggggctga ccgcggggcc tgggccaggg tctcacactt       660
     ggcagaggat gtatggctgc gacctggggc ccgacgggcg cctcctccgc gggtataacc       720
     agttagccta cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg       780
     cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc       840
     aggacagagc ctacctggag ggcctgtgcg tggagtcgct ccgcagatac ctggagaacg       900
     ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctccta       960
     taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag cgctagaatg      1020
     tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg agggccccct      1080
     cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga agacagtccc      1140
     tagaatactg atcaggggtc ccctttgacc cctgcagcag ccttgggaac cgtgactttc      1200
     ctctcaggcc ttgttctctg cctcacactc agtgtgtttg gggctctgat tccagcactt      1260
     ctgagtcact ttacctccac tcagatcggg agcagaagtc cctgttcccc gctcagagac      1320
     tcgaactttc caatgaatag gagattatcc caggtgcctg cgtccaggct ggtgtctggg      1380
     ttctgtgccc cttccccacc ccaggtgtcc tgtccattct caggctggtc acatgggtgg      1440
     tcctagggtg tcccatgaga gatgcaaagc gcctgaattt tctgactctt cccatcagac      1500
     cccccaaaga cacatgtgac ccaccacccc atctctgacc gtgaggccac cctgaggtgc      1560
     tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga tggcgaggac      1620
     caaactcagg acaccgagct tgtggagacc agaccagcag gagatagaac cttccagaag      1680
     tgggcagctg tggtggtgcc ttctggagaa gagcagagat acacatgcca tgtacagcat      1740
     gaggggctgc cgaagcccct caccctgaga tggggtaagg agggggatga ggggtcatat      1800
     ctgttctcag ggaaagcagg agcccttctg gagcccttca gcagggtcag ggcccctcat      1860
     cttcccctcc tttcccag                                                    1878
//