spacer

EBI Dbfetch

ID   AY619993; SV 1; linear; genomic DNA; STD; HUM; 2004 BP.
XX
AC   AY619993;
XX
DT   14-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate 38528S MHC class I antigen precusor (HLA-A) gene,
DE   HLA-A*300203 allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2004
RA   Robbins F.-M., Adams S., Simonis T., Theodore W., Stroncek D.;
RT   "Identification of novel class I alleles by direct sequencing of SSP-PCR
RT   products";
RL   Unpublished.
XX
RN   [2]
RP   1-2004
RA   Robbins F.-M., Adams S., Simonis T., Theodore W., Stroncek D.;
RT   ;
RL   Submitted (07-MAY-2004) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 43d972feb5b60a5974844fb25c827af0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2004
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="38528S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>2004
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT   mRNA            join(1..127,258..527,769..1044,1624..1899,2002..>2004)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT                   /product="MHC class I antigen precusor"
FT   exon            1..127
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT                   /number=1
FT   5'UTR           1..54
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT   CDS             join(55..127,258..527,769..1044,1624..1899,2002..>2004)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT                   /product="MHC class I antigen precusor"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q6IVJ6"
FT                   /db_xref="IMGT/HLA:A*30:02:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IVJ6"
FT                   /protein_id="AAT44889.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQTDRENLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARRAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWE"
FT   sig_peptide     55..126
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT   exon            258..527
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT                   /number=2
FT   exon            769..1044
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT                   /number=3
FT   exon            1624..1899
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT                   /number=4
FT   exon            2002..>2004
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300203"
FT                   /number=5
XX
SQ   Sequence 2004 BP; 379 A; 620 C; 648 G; 357 T; 0 other;
     gttctaaagc ccgcacgcac ccaccgggac tcagattctc cccagacgcc gaggatggcc        60
     gtcatggcgc cccgaaccct cctcctgcta ctctcggggg ccctggccct gacccagacc       120
     tgggcgggtg agtgcggggt cgggagggaa accgcctctg cggggagaag caaggggccc       180
     tcctggcggg ggcgcaggac cgggggagcc gcgccgggag gagggtcggt caggtctcag       240
     ccactgctcg cccccaggct cccactccat gaggtatttc tccacatccg tgtcccggcc       300
     cggcagtgga gagccccgct tcatcgcagt gggctacgtg gacgacacgc agttcgtgcg       360
     gttcgacagc gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga       420
     gaggccagag tattgggacc aggagacacg gaatgtgaag gcccactcac agactgaccg       480
     agagaacctg gggaccctgc gcggctacta caaccagagc gaggccggtg agtgaccccg       540
     cccgggggcg caggtcacga cccctcatcc cccacggacg ggccaggtcg cccacagtct       600
     ccgggtccga gatccacccc gaagccgcgg gaccccgaga cccttgaccc gggagaggcc       660
     caggcgcctt tacccggttt cattttcagt ttaggccaaa aattcccccg ggttggtcgg       720
     ggctgggcgg ggctcggggg actgggctga ccgcggggtc ggggccaggt tctcacacca       780
     tccagataat gtatggctgc gacgtggggt cggacgggcg cttcctccgc gggtatgaac       840
     agcacgccta cgacggcaag gattacatcg ccctgaacga ggacctgcgc tcttggaccg       900
     cggcggacat ggcggctcag atcacccagc gcaagtggga ggcggcccgt cgggcggagc       960
     agttgagagc ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg      1020
     ggaaggagac gctgcagcgc acgggtacca ggggccacgg ggcgccttcc tgatcgcctg      1080
     tagatctccc gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata      1140
     tcaccctccc tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag      1200
     agagtgactc tgaggttccg ccctgctctc tgactcaatt aagggataaa atctctgaag      1260
     gagtgacggg aagacgatcc ctcgaatact gatgagtggt tccctttgac accggcagca      1320
     gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact caatgtgtgt      1380
     gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag gaccagaagt      1440
     cgctgttccc ttctcaggga atagaagatt atcccaggtg cctgtgtcca ggctggtgtc      1500
     tgggttctgt gctctcttcc ccatcccggg tgtcctgtcc attctcaaga tggccacatg      1560
     cgtgctggtg gagtgtccca tgacagatgc aaaatgcctg aattttctga ctcttcccgt      1620
     cagacccccc caagacacat atgacccacc accccatctc tgaccatgag gccaccctga      1680
     ggtgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag cgggatgggg      1740
     aggaccagac ccaggacacg gagctcgtgg agaccaggcc tgcaggggat ggaaccttcc      1800
     agaagtgggc ggctgtggtg gtgccttctg gagaggagca gagatacacc tgccatgtgc      1860
     agcatgaggg tctgcccaag cccctcaccc tgagatgggg taaggaggga gatgggggtg      1920
     tcatgtctct tagggaaagc aggagcctct ctggagacct ttagcagggt cagggcccct      1980
     caccttcccc tcttttccca gagc                                             2004
//


spacer
spacer