spacer

EBI Dbfetch

ID   AY619992; SV 1; linear; genomic DNA; STD; HUM; 2004 BP.
XX
AC   AY619992;
XX
DT   09-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate 40148S MHC class I antigen precusor (HLA-A) gene,
DE   HLA-A*240204 allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2004
RA   Robbins F.-M., Adams S., Dinh S., Marincola F.;
RT   "Identification of novel HLA class I alleles by direct sequencing of
RT   SSP-PCR products";
RL   Unpublished.
XX
RN   [2]
RP   1-2004
RA   Robbins F.-M., Adams S., Dinh S., Marincola F.;
RT   ;
RL   Submitted (07-MAY-2004) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; f7a226e1c0027d6c54f41898cbd58e38.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2004
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="40148S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>2004
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT   mRNA            join(1..127,258..527,769..1044,1624..1899,2002..>2004)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT                   /product="MHC class I antigen precusor"
FT   exon            1..127
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT                   /number=1
FT   5'UTR           1..54
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT   CDS             join(55..127,258..527,769..1044,1624..1899,2002..>2004)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT                   /product="MHC class I antigen precusor"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q6IVJ7"
FT                   /db_xref="IMGT/HLA:A*24:02:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IVJ7"
FT                   /protein_id="AAT41625.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWE"
FT   sig_peptide     55..126
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT   exon            258..527
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT                   /number=2
FT   exon            769..1044
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT                   /number=3
FT   exon            1624..1899
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT                   /number=4
FT   exon            2002..>2004
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*240204"
FT                   /number=5
XX
SQ   Sequence 2004 BP; 382 A; 624 C; 646 G; 352 T; 0 other;
     gttctaaagt ccgcacgcac ccaccgggac tcagattctc cccagacgcc gaggatggcc        60
     gtcatggcgc cccgaaccct cgtcctgcta ctctcggggg ccctggccct gacccagacc       120
     tgggcaggtg agtgcggggt cgggagggaa acggcctctg cggggagaag caaggggccc       180
     gcctggcggg ggcgcaagac ccgggaagcc gcgccgggag gagggtcggg cgggtctcag       240
     ccactcctcg tccccaggct cccactccat gaggtatttc tccacatccg tgtcccggcc       300
     cggccgcggg gagccccgct tcatcgccgt gggctacgtg gacgacacgc agttcgtgcg       360
     gttcgacagc gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga       420
     ggggccggag tattgggacg aggagacagg gaaagtgaag gcccactcac agactgaccg       480
     agagaacctg cggatcgcgc tccgctacta caaccagagc gaggccggtg agtgaccccg       540
     gcccggggcg caggtcacga cccctcatcc cccacggacg ggccgggtcg cccacagtct       600
     ccgggtccga gatccacccc gaagccgcgg gaccccgaga cccttgcccc gggagaggcc       660
     caggcgcctt aacccggttt cattttcagt ttaggccaaa aatccccccg ggttggtcgg       720
     ggccgggcgg ggctcggggg actgggctga ccgcggggtc ggggccaggt tctcacaccc       780
     tccagatgat gtttggctgc gacgtggggt cggacgggcg cttcctccgc gggtaccacc       840
     agtatgccta cgacggcaag gattacatcg ccctgaaaga ggacctgcgc tcttggaccg       900
     cggcggacat ggcggctcag atcaccaagc gcaagtggga ggcggcccat gtggcggagc       960
     agcagagagc ctacctggag ggcacgtgcg tggacgggct ccgcagatac ctggagaacg      1020
     ggaaggagac gctgcagcgc acgggtacca ggggccacgg ggcgcctacc tgatcgcctg      1080
     taggtctccc gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata      1140
     tcgccctccc tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag      1200
     agagtgactc tgaggttccg ccctgctctc tgacacaatt aagggataaa atctctgacg      1260
     gaatgacgga aagacgatcc ctcgaatact gatgactggt tccctttgac accggcagca      1320
     gccttgggac cgtgactttt cctctcaggc cttgttctct gcttcacact caatgtgtgt      1380
     gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag gaccagaagt      1440
     cgctgttccc tcctcaggga atagaagatt atcccaggtg cctgtgtcca ggctggtgtc      1500
     tgggttctgt gctctcttcc ccatcccggg tgtcctgtcc attctcaaga tggccacatg      1560
     catgctggtg gagtgtccca tgacagatgc aaaatgcctg aattttctga ctcttcccgt      1620
     cagacccccc caagacacat atgacccacc accccatctc tgaccatgag gccactctga      1680
     gatgctgggc cctgggcttc taccctgcgg agatcacact gacctggcag cgggatgggg      1740
     aggaccagac ccaggacacg gagcttgtgg agaccaggcc tgcaggggat ggaaccttcc      1800
     agaagtgggc agctgtggtg gtaccttctg gagaggagca gagatacacc tgccatgtgc      1860
     agcatgaggg tctgcccaag cccctcaccc tgagatgggg taaggaggga gatgggggtg      1920
     tcatgtctct tagggaaagc aggagcctct ctggagacct ttagcagggt cagggcccct      1980
     caccttcccc tcttttccca gagc                                             2004
//


spacer
spacer