spacer

EBI Dbfetch

ID   AY619990; SV 1; linear; genomic DNA; STD; HUM; 1993 BP.
XX
AC   AY619990;
XX
DT   09-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate 29240S MHC class I antigen precusor (HLA-A) gene,
DE   HLA-A*0317 allele, exons 1 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1993
RA   Robbins F.-M., Adams S., West S., Arioglu E., Klein H.;
RT   "Identification of novel HLA class I alleles by direct sequencing of
RT   SSP-PCR products";
RL   Unpublished.
XX
RN   [2]
RP   1-1993
RA   Robbins F.-M., Adams S., West S., Arioglu E., Klein H.;
RT   ;
RL   Submitted (07-MAY-2004) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 02ca6975db58e70986ec055f6841b313.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1993
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="29240S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1993
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT   mRNA            join(1..117,248..517,759..1034,1613..1888,1991..>1993)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT                   /product="MHC class I antigen precusor"
FT   exon            1..117
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT                   /number=1
FT   5'UTR           1..44
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT   CDS             join(45..117,248..517,759..1034,1613..1888,1991..>1993)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT                   /product="MHC class I antigen precusor"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="GOA:Q6IVJ9"
FT                   /db_xref="IMGT/HLA:A*03:17:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IVJ9"
FT                   /protein_id="AAT41623.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWE"
FT   sig_peptide     45..116
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT   exon            248..517
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT                   /number=2
FT   exon            759..1034
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT                   /number=3
FT   exon            1613..1888
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT                   /number=4
FT   exon            1991..>1993
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0317"
FT                   /number=5
XX
SQ   Sequence 1993 BP; 371 A; 619 C; 653 G; 350 T; 0 other;
     ccgcacgcac ccaccgggac tcagattctc cccagacgcc gaggatggcc gtcatggcgc        60
     cccgaaccct cctcctgcta ctctcggggg ccctggccct gacccagacc tgggcgggtg       120
     agtgcggggt cgggagggaa accgcctctg cggggagaag caaggggccc tcctggcggg       180
     ggcgcaggac cgggggagcc gcgccgggac gagggtcggg caggtctcag ccactgctcg       240
     cccccaggct cccactccat gaggtatttc ttcacatccg tgtcccggcc cggccgcggg       300
     gagccccgct tcatcgccgt gggctacgtg gacgacacgc agttcgtgcg gttcgacagc       360
     gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga ggggccggag       420
     tattgggacc aggagacacg gaatgtgaag gcccagtcac agactgaccg agtggacctg       480
     gggaccctgc gcggctacta caaccagagc gaggccggtg agtgaccccg gccgggggcg       540
     caggtcagga cccctcatcc cccacggacg ggccaggtcg cccacagtct ccgggtccga       600
     gatccacccc gaagccgcgg gaccccgaga cccttgcccc gggagaggcc caggcgcctt       660
     tacccggttt cattttcagt ttaggccaaa aatccccccg ggttggtcgg ggctgggcgg       720
     ggctcggggg actgggctga ccgcggggtc ggggccaggt tctcacacca tccagataat       780
     gtatggctgc gacgtggggt cggacgggcg cttcctccgc gggtaccggc aggacgccta       840
     cgacggcaag gattacatcg ccctgaaaga ggacctgcgc tcttggaccg cggcggacat       900
     ggcggctcag atcaccaagc gcaagtggga ggcggcccat gaggcggagc agttgagagc       960
     ctacctggat ggcacgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac      1020
     gctgcagcgc acgggtacca ggggccacgg ggcgcctccc tgatcgcctg tagatctccc      1080
     gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata tcaccctccc      1140
     tctggtcctg agggagagga atcctcctgg gttccagatc ctgtaccaga gagtgactct      1200
     gaggttccgc cctgctctct gacacaatta agggataaaa tctctgaagg agtgacggga      1260
     agacgatccc tcgaatactg atgagtggtt ccctttgaca ccggcagcag ccttgggccc      1320
     gtgacttttc ctctcaggcc ttgttctctg cttcacactc aatgtgtgtg ggggtctgag      1380
     tccagcactt ctgagtccct cagcctccac tcaggtcagg accagaagtc gctgttccct      1440
     tctcagggaa tagaagatta tcccaggtgc ctgtgtccag gctggtgtct gggttctgtg      1500
     ctctcttccc catcccgggt gtcctgtcca ttctcaagat ggccacatgc gtgctggtgg      1560
     agtgtcccat gacagatgca aaatgcctga attttctgac tcttcccgtc agaccccccc      1620
     aagacacata tgacccacca ccccatctct gaccatgagg ccaccctgag gtgctgggcc      1680
     ctgggcttct accctgcgga gatcacactg acctggcagc gggatgggga ggaccagacc      1740
     caggacacgg agctcgtgga gaccaggcct gcaggggatg gaaccttcca gaagtgggcg      1800
     gctgtggtgg tgccttctgg agaggagcag agatacacct gccatgtgca gcatgagggt      1860
     ctgcccaagc ccctcaccct gagatggggt aaggagggag atgggggtgt catgtctctt      1920
     agggaaagca ggagcctctc tggagacctt tagcagggtc agggcccctc accttcccct      1980
     cttttcccag agc                                                         1993
//


spacer
spacer