Dbfetch

ID   AY619719; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY619719;
XX
DT   07-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2004.00320.x.
RX   PUBMED; 15496208.
RA   Lv F., Gao J., Lin J., Liu Z., Xu Y., Ren X., Zhang H., Xu A.;
RT   "Characterization of a novel HLA-DQB1 allele, DQB1*020102";
RL   Tissue Antigens 64(5):619-620(2004).
XX
RN   [2]
RP   1-270
RA   Lv F., Gao J., Lin J., Liu Z., Xu A.;
RT   ;
RL   Submitted (07-MAY-2004) to the INSDC.
RL   Department of Biochemistry and Molecular Biology, School of Life Sciences,
RL   Sun Yat-sen University, #135 West Xingang Rd., Guangzhou, Guangdong 510275,
RL   China
XX
DR   MD5; ec2ac441c125e593dd65befce8de67f7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6IVL2"
FT                   /db_xref="IMGT/HLA:DQB1*02:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6IVL2"
FT                   /protein_id="AAT39543.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAV
FT                   TLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1 variant"
FT                   /number=2
FT   variation       167
FT                   /gene="HLA-DQB1"
FT                   /replace="c"
FT                   /note="compared to HLA-DQB1*0201"
XX
SQ   Sequence 270 BP; 61 A; 66 C; 96 G; 47 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggaca gagcgcgtgc        60
     gtcttgtgag cagaagcatc tataaccgag aagagatcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg ctgctggggc tgcctgccgc cgagtattgg aacagccaga       180
     aggacatcct ggagaggaaa cgggcggcgg tggacagggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//