spacer

EBI Dbfetch

ID   AY618897; SV 1; linear; genomic DNA; STD; HUM; 256 BP.
XX
AC   AY618897;
XX
DT   08-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*31 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-256
RX   DOI; 10.1111/j.1399-0039.2005.00429.x.
RX   PUBMED; 15982263.
RA   Sheldon M.H., Azzaro M.P., Sayer D., Bunce M., Sortino G.;
RT   "Identification of a new allele in a Sicilian individual: HLA-DPB1*0302";
RL   Tissue Antigens 66(1):64-66(2005).
XX
RN   [2]
RP   1-256
RA   Sheldon M.H., Sortino G., Azzaro M.P.;
RT   ;
RL   Submitted (06-MAY-2004) to the INSDC.
RL   R&D, Dynal Biotech Ltd., 11 Bassendale Road, Bromborough, Wirral CH62 3QL,
RL   UK
XX
DR   MD5; 7eaa4f3f2b7036492580dd83b8dd9519.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..256
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>256
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*31 variant"
FT   mRNA            <1..>256
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*31 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>256
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*31 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*102:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAT40308.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTE
FT                   LGRPAAEYWNSQKDLLEEKRAVPDRMCRHNYELDEAVTL"
XX
SQ   Sequence 256 BP; 59 A; 64 C; 93 G; 40 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt tcgcgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg ctgcggagta ctggaacagc cagaaggacc       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctggacg       240
     aggccgtgac cctgca                                                       256
//


spacer
spacer