spacer

EBI Dbfetch

ID   AY618553; SV 1; linear; genomic DNA; STD; HUM; 294 BP.
XX
AC   AY618553;
XX
DT   11-FEB-2005 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPA1) gene, HLA-DPA1*0303 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-294
RX   DOI; 10.1111/j.1399-0039.2005.00339.x.
RX   PUBMED; 15663751.
RA   Luo M., Bamforth J., Gill K., Cohen C., Brunham R.C., Plummer F.A.;
RT   "High-resolution sequence-based DPA1 typing identified two novel DPA1
RT   alleles, DPA1*010303 and DPA1*0303, from a Kenyan population";
RL   Tissue Antigens 65(1):120-122(2005).
XX
RN   [2]
RP   1-294
RA   Luo M., Bamforth J., Gill K., Cohen C., Brunham R., Plummer F.A.;
RT   ;
RL   Submitted (05-MAY-2004) to the INSDC.
RL   Medical Microbiology, University of Manitoba, R507, BMSB, 730 William
RL   Avenue, Winnipeg, Manitoba R3E 0W3, Canada
XX
DR   MD5; d084e093a824dbf41662aa85f3216238.
DR   Ensembl-Gn; ENSG00000168384; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206291; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224103; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228163; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229685; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231389; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235844; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236177; homo_sapiens.
DR   Ensembl-Tr; ENST00000374808; homo_sapiens.
DR   Ensembl-Tr; ENST00000383224; homo_sapiens.
DR   Ensembl-Tr; ENST00000415247; homo_sapiens.
DR   Ensembl-Tr; ENST00000419277; homo_sapiens.
DR   Ensembl-Tr; ENST00000422504; homo_sapiens.
DR   Ensembl-Tr; ENST00000443117; homo_sapiens.
DR   Ensembl-Tr; ENST00000454805; homo_sapiens.
DR   Ensembl-Tr; ENST00000515317; homo_sapiens.
DR   Ensembl-Tr; ENST00000617497; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..294
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="Kenya"
FT                   /sex="female"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>294
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*0303"
FT   mRNA            <16..>261
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*0303"
FT                   /product="MHC class II antigen"
FT   CDS             <16..>261
FT                   /codon_start=3
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*0303"
FT                   /product="MHC class II antigen"
FT                   /note="presenting pepetide to CD4 T cells"
FT                   /db_xref="GOA:P20036"
FT                   /db_xref="HGNC:HGNC:4938"
FT                   /db_xref="IMGT/HLA:DPA1*03:03"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20036"
FT                   /protein_id="AAT92097.1"
FT                   /translation="DHVSTYAMFVQTHRPTGEFMFEFDDDEMFYVDLDKKETVWHLEEF
FT                   GQAFSFEAQGGLANIAISNNNLNTLIQRSNHTQATN"
FT   exon            16..261
FT                   /gene="HLA-DPA1"
FT                   /allele="HLA-DPA1*0303"
FT                   /number=2
XX
SQ   Sequence 294 BP; 70 A; 73 C; 69 G; 82 T; 0 other;
     actttcttta tgcagcggac catgtgtcaa cttatgccat gtttgtacag acccatagac        60
     caacagggga gtttatgttt gaatttgatg acgatgagat gttctatgtg gatctggaca       120
     agaaggagac cgtctggcat ctggaggagt ttggccaagc cttttccttt gaggctcagg       180
     gcgggctggc taacattgct atatcgaaca acaacttgaa taccttgatc cagcgttcca       240
     accacactca ggccaccaac ggtacgccct atctttgcct cttcctctgt agcc             294
//


spacer
spacer