spacer

EBI Dbfetch

ID   AY607029; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY607029;
XX
DT   22-JUN-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate NT00510 MHC class II antigen (DRB1) gene, DRB1*030101
DE   variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Burdett L., Fernandez-Vina M., Hurley C.K.;
RT   "Novel HLA-DRB1*03 variant allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Burdett L., Fernandez-Vina M., Hurley C.K.;
RT   ;
RL   Submitted (26-APR-2004) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Road, NW, Washington, DC
RL   20057, USA
XX
DR   MD5; 423927f632a0bfcd1106e5c714fd3e88.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="NT00510"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*030101 variant"
FT   mRNA            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*030101 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1"
FT                   /allele="DRB1*030101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6GYF6"
FT                   /db_xref="IMGT/HLA:DRB1*03:28"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GYF6"
FT                   /protein_id="AAT46361.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TKLGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="DRB1"
FT                   /allele="DRB1*030101 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 64 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg aagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer