Dbfetch

ID   AH014145; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AH014145; AY604038; AY763540-AY763542;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1586 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Yang Y., Aubrey M.T., Offord L., Freed B.M.;
RT   "A new chimeric HLA B15/B22 allele with short B62 and short B22 serology
RT   characterized by HaploPrep separation and sequence-based typing";
RL   Hum. Immunol. 65(9-101001):S104-S104(2004).
XX
RN   [2]
RP   1-1022
RA   Yang Y., Aubrey M., Freed B., Zhang G., Ji Y., Offord L.;
RT   "A new chimeric HLA B15/B22 allele (B*1586) with short B15 and short B22
RT   serology characterized by HaploPrep separation combined with sequence-based
RT   typing";
RL   Unpublished.
XX
RN   [3]
RP   1-1022
RA   Yang Y., Aubrey M., Freed B., Zhang G., Ji Y., Offord L.;
RT   ;
RL   Submitted (24-SEP-2004) to the INSDC.
RL   Shanghai Blood Center, Immunogenetics Lab, 1191 Hongqiao Rd, Shanghai
RL   200051, China
XX
DR   MD5; 915dacaf5424b0fa523de43a5f9df2cf.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:52854343, gi:52854344, gi:52854345, gi:52854342.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="leukemia patient"
FT                   /note="identical sequence obtained from healthy sibling"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1586"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1586"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1586"
FT                   /product="MHC class I antigen"
FT                   /note="B region; leukocyte antigen"
FT                   /db_xref="GOA:Q5XL22"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XL22"
FT                   /protein_id="AAU88210.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1586"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1586"
FT                   /number=3
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1586"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 180 A; 257 C; 271 G; 114 T; 200 other;
     GCTCCCACTC CATGAGGTAT TTCTACACCG CCATGTCCCG GCCCGGCCGC GGGGAGCCCC        60
     GCTTCATCGC AGTGGGCTAC GTGGACGACA CCCAGTTCGT GAGGTTCGAC AGCGACGCCG       120
     CGAGTCCGAG GATGGCGCCC CGGGCGCCAT GGATAGAGCA GGAGGGGCCG GAGTATTGGG       180
     ACCGGGAGAC ACAGATCTCC AAGACCAACA CACAGACTTA CCGAGAGAGC CTGCGGAACC       240
     TGCGCGGCTA CTACAACCAG AGCGAGGCCG NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN       300
     NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN       360
     NNNNNNNNNN GGTCTCACAC CCTCCAGAGG ATGTATGGCT GCGACCTGGG GCCGGACGGG       420
     CGCCTCCTCC GCGGGCATAA CCAGTTAGCC TACGACGGCA AGGATTACAT CGCCCTGAAC       480
     GAGGACCTGA GCTCCTGGAC CGCGGCGGAC ACCGCGGCTC AGATCACCCA GCGCAAGTGG       540
     GAGGCGGCCC GTGTGGCGGA GCAGCTGAGA GCCTACCTGG AGGGCACGTG CGTGGAGTGG       600
     CTCCGCAGAT ACCTGGAGAA CGGGAAGGAG ACGCTGCAGC GCGCGGNNNN NNNNNNNNNN       660
     NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN       720
     NNNNNNNNNN NNNNNNNNNN NNNNNNACCC CCCAAAGACA CACGTGACCC ACCACCCCAT       780
     CTCTGACCAT GAGGCCACCC TGAGGTGCTG GGCCCTGGGC TTCTACCCTG CGGAGATCAC       840
     ACTGACCTGG CAGCGGGATG GCGAGGACCA AACTCAGGAC ACTGAGCTTG TGGAGACCAG       900
     ACCAGCAGGA GATAGAACCT TCCAGAAGTG GGCAGCTGTG GTGGTGCCTT CTGGAGAAGA       960
     GCAGAGATAC ACATGCCATG TACAGCATGA GGGGCTGCCG AAGCCCCTCA CCCTGAGATG      1020
     GG                                                                     1022
//