Dbfetch

ID   AY585236; SV 1; linear; genomic DNA; STD; HUM; 944 BP.
XX
AC   AY585236;
XX
DT   12-MAY-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQA1) gene, HLA-DQA1*01 new allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-944
RA   Hancock L.N., Cordovado S.K., Mueller P.W.;
RT   "Identification of a Novel HLA-DQA1*01 Allele Detected by Sequence-Based
RT   Typing";
RL   Unpublished.
XX
RN   [2]
RP   1-944
RA   Cordovado S.K., Hancock L.N., Mueller P.W.;
RT   ;
RL   Submitted (29-MAR-2004) to the INSDC.
RL   NCEH/DLS/MBB/DMRAS, Centers for Disease Control and Prevention, 4770 Buford
RL   Highway MS F-50, Atlanta, GA 30341, USA
XX
DR   MD5; 55a1af61e2a9f3cf9233a0791875a838.
DR   Ensembl-Gn; ENSG00000196735; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232062; homo_sapiens.
DR   Ensembl-Tr; ENST00000343139; homo_sapiens.
DR   Ensembl-Tr; ENST00000374949; homo_sapiens.
DR   Ensembl-Tr; ENST00000383251; homo_sapiens.
DR   Ensembl-Tr; ENST00000395363; homo_sapiens.
DR   Ensembl-Tr; ENST00000399675; homo_sapiens.
DR   Ensembl-Tr; ENST00000399678; homo_sapiens.
DR   Ensembl-Tr; ENST00000418023; homo_sapiens.
DR   Ensembl-Tr; ENST00000444296; homo_sapiens.
DR   Ensembl-Tr; ENST00000548014; homo_sapiens.
DR   IMGT/LIGM; AY585236.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..944
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>944
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01 new"
FT   mRNA            join(<1..249,663..>944)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01 new"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..249,663..>944)
FT                   /codon_start=3
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01 new"
FT                   /product="MHC class II antigen"
FT                   /note="binds to T-cell receptor"
FT                   /db_xref="GOA:P01909"
FT                   /db_xref="HGNC:HGNC:4942"
FT                   /db_xref="IMGT/HLA:DQA1*01:07"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR032431"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01909"
FT                   /protein_id="AAT09985.1"
FT                   /translation="DHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPE
FT                   FSKFGGFDPQGALRNMAVAKHNLNIMIKCYNSTAATNEVPEVTVFSKSPVTLGQPNTLI
FT                   CLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKV
FT                   EHWGLDQPLLKHW"
FT   exon            <1..249
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01 new"
FT                   /number=2
FT   variation       222
FT                   /gene="HLA-DQA1"
FT                   /replace="c"
FT                   /note="as compared to HLA-DQA1*010101 allele; results in
FT                   cysteine to arginine amino acid change"
FT   exon            663..>944
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*01 new"
FT                   /number=3
XX
SQ   Sequence 944 BP; 236 A; 243 C; 208 G; 257 T; 0 other;
     ctgaccacgt tgcctcttgt ggtgtaaact tgtaccagtt ttacggtccc tctggccagt        60
     acacccatga atttgatgga gatgaggagt tctacgtgga cctggagagg aaggagactg       120
     cctggcggtg gcctgagttc agcaaatttg gaggttttga cccgcagggt gcactgagaa       180
     acatggctgt ggcaaaacac aacttgaaca tcatgattaa atgctacaac tctaccgctg       240
     ctaccaatgg tatgcgtcca ccattctgcc tctctttact taagctatcc ctccatacca       300
     gggttcatta ttttcttccc aagaggtccc cagatcttct tatggcaatt gctgaaattt       360
     tatcatctcc catctctaaa atcacatatt cccatgtaat acaagggtct ttccattatg       420
     cattcagcaa atccttctag gagaggtctc atcaacctcc tactttatta aacatgccca       480
     cagagagaag ggcacaggaa taaagcagag gcaatgtgtc gttgctccca agcagaaggt       540
     aaataagacc tctttgacta tcaggtggtg aaatgctggt aggagggctc ttccaggatg       600
     taatgcagaa cttcagggca gagctattca cacttcacac cagtgctgtt tcctcaccac       660
     agaggttcct gaggtcacag tgttttccaa gtctcccgtg acactgggtc agcccaacac       720
     cctcatttgt cttgtggaca acatctttcc tcctgtggtc aacatcacat ggctgagcaa       780
     tgggcagtca gtcacagaag gtgtttctga gaccagcttc ctctccaaga gtgatcattc       840
     cttcttcaag atcagttacc tcaccttcct cccttctgct gatgagattt atgactgcaa       900
     ggtggagcac tggggcctgg accagcctct tctgaaacac tggg                        944
//