Dbfetch

ID   AY574934; SV 1; linear; genomic DNA; STD; HUM; 1705 BP.
XX
AC   AY574934;
XX
DT   14-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*01varNull allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1705
RX   DOI; 10.1016/j.humimm.2005.06.010.
RX   PUBMED; 16216676.
RA   Reinders J., Rozemuller E.H., Otten H.G., Houben A.J., Dormoy A.,
RA   Mulder A., van den Tweel J.G., Petersen E.J., Tilanus M.G.;
RT   "Identification of HLA-A*0111N: a synonymous substitution, introducing an
RT   alternative splice site in exon 3, silenced the expression of an HLA-A
RT   allele";
RL   Hum. Immunol. 66(8):912-920(2005).
XX
RN   [2]
RP   1-1705
RA   Tilanus M.G.J., Houben A.J.S., Rozemuller E.H.;
RT   "A new HLA-A 01 null allele, caused by a synonymous substitution in exon 3
RT   introducing a new splice site";
RL   Unpublished.
XX
RN   [3]
RP   1-1705
RA   Tilanus M.G.J., Houben A.J.S., Rozemuller E.H.;
RT   ;
RL   Submitted (17-MAR-2004) to the INSDC.
RL   Pathology, University Medical Centre, Utrecht, P.O.Box 85500, Utrecht
RL   3508GA, The Netherlands
XX
DR   MD5; 89a51a186ecb7f680c24ccb018836292.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1705
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1705
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01varNull"
FT   mRNA            join(<1..73,204..473,715..966,1570..>1705)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01varNull"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..966,1570..>1705)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01varNull"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*01:11N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PW03"
FT                   /protein_id="AAS87370.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENDPPKTHMTHHPISDHEATLRCWAL
FT                   GFYPAEITLTWQRDGEDQTQDT"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01varNull"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01varNull"
FT                   /number=2
FT   exon            715..966
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01varNull"
FT                   /number=3
FT   exon            1570..>1705
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01varNull"
FT                   /number=4
XX
SQ   Sequence 1705 BP; 317 A; 537 C; 553 G; 298 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcgggcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaagatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac       420
     tgaccgagcg aacctgggga ccctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggact ccgagaccct tgtcccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcg gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagatca ccaagcgcaa gtgggaggcg gtccatgcgg       900
     cggagcagcg gagagtctac ctggagggcc ggtgcgtgga cgggctccgc agatacctgg       960
     agaacggtaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctataga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggagt gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg      1260
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtctctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcccttct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcgtg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacac                                            1705
//