Dbfetch

ID   AY574194; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY574194;
XX
DT   27-MAY-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (DRB1) gene, DRB1*1117 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2006.00534.x.
RX   PUBMED; 16441502.
RA   Ozzella G., Monaco P.I., Tessitore A., Piazza A., Piancatelli D.,
RA   Adorno D.;
RT   "Identification of a novel HLA-DRB1*11 allele: DRB1*1152";
RL   Tissue Antigens 67(2):180-182(2006).
XX
RN   [2]
RP   1-270
RA   Ozzella G., Monaco P.I.F., Tessitore A., Piazza A., Piancatelli D.,
RA   Adorno D.;
RT   ;
RL   Submitted (16-MAR-2004) to the INSDC.
RL   Istituto per i Trapianti d' Organo e l' Immunocitologia - Sezione di Roma,
RL   Consiglio Nazionale delle Ricerche, Piazzale dell' Umanesimo, 10, Roma
RL   00144, Italia
XX
DR   MD5; 852fd063bdc7d48c7013d93c28c21c01.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*1117 variant"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1"
FT                   /allele="DRB1*1117 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6J8I8"
FT                   /db_xref="IMGT/HLA:DRB1*11:52"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6J8I8"
FT                   /protein_id="AAT29062.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDEEHWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="DRB1"
FT                   /allele="DRB1*1117 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 63 C; 100 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatga ggagcactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ttgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//