spacer

EBI Dbfetch

ID   AY572830; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AY572830;
XX
DT   05-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*0202 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Wu J., Williams T.M., Cognato M.A.;
RT   "Novel human HLA-DPB1 allele identified in potential bone marrow donors";
RL   Unpublished.
XX
RN   [2]
RP   1-264
RA   Wu J., Williams T.M., Cognato M.A.;
RT   ;
RL   Submitted (12-MAR-2004) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino De Salud NE, Albuquerque,
RL   NM 87131, USA
XX
DR   MD5; 724071f96b4fac8e3291262fb2084958.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*101:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAS77869.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTE
FT                   LGRPEAEYWHSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*0202"
FT                   /number=2
XX
SQ   Sequence 264 BP; 59 A; 67 C; 99 G; 39 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagc tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg aggcggagta ctggcacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer