spacer

EBI Dbfetch

ID   AY569160; SV 1; linear; mRNA; STD; HUM; 822 BP.
XX
AC   AY569160;
XX
DT   06-APR-2004 (Rel. 79, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*35 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Chang Y.;
RT   "Novel HLA-B*35 allele identified by nucleotide sequencing";
RL   Unpublished.
XX
RN   [2]
RP   1-822
RA   Chang Y.;
RT   ;
RL   Submitted (08-MAR-2004) to the INSDC.
RL   7050, All Children's Hospital, 801 6Th Street South, St. Petersburg, FL
RL   33701, USA
XX
DR   MD5; a41f2f8e85c884154424ed1ca0b070d2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>822
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT   CDS             <1..>822
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6Q0M4"
FT                   /db_xref="IMGT/HLA:B*35:49"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6Q0M4"
FT                   /protein_id="AAS79490.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 822 BP; 179 A; 256 C; 272 G; 115 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacat catccagagg atgtatggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcggaccc cccaaagaca cacgtgaccc accaccccgt ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gcgaggacca aactcaggac actgagcttg tggagaccag accagcagga gatagaacct       720
     tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga gcagagatac acatgccatg       780
     tacagcatga ggggctgccg aagcccctca ccctgagatg gg                          822
//


spacer
spacer