spacer

EBI Dbfetch

ID   AY561761; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY561761;
XX
DT   11-JUL-2004 (Rel. 80, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2616var allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Yan W.Y., Xu R., Xie S.M., Yang C., Wang X.D., Zhu N., Pan J., Jiang X.F.,
RA   Li J.X., Li Z.J., Pei X.T.;
RT   "A HLA-A*26 new allele identified in potential umbilical cord blood
RT   donors";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Yan W.Y., Xu R., Xie S.M., Yang C., Wang X.D., Zhu N.;
RT   ;
RL   Submitted (28-FEB-2004) to the INSDC.
RL   HLA Typing Laboratory, Shandong Umbilical Cord Blood Bank, South Second
RL   Cycle Road, Jinan, Shandong Province 250002, China
XX
DR   MD5; 97451517dd68bf98facbd58885825131.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="umbilical cord blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2616var"
FT   mRNA            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2616var"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2616var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6E5A2"
FT                   /db_xref="IMGT/HLA:A*26:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6E5A2"
FT                   /protein_id="AAT68270.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSED"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2616var"
FT                   /number=2
XX
SQ   Sequence 270 BP; 54 A; 84 C; 94 G; 38 T; 0 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg                                        270
//


spacer
spacer