Dbfetch

ID   AY536008; SV 1; linear; genomic DNA; STD; HUM; 300 BP.
XX
AC   AY536008;
XX
DT   04-MAR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-300
RA   Bois M., Dormoy A., Jollet I.;
RT   "A new HLA-DRB1*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-300
RA   Bois M., Dormoy A., Jollet I.;
RT   ;
RL   Submitted (30-JAN-2004) to the INSDC.
RL   Histocompatibility, Efs-Ca, 350 Avenue Jacques Coeur, Poitiers 86012,
RL   France
XX
DR   MD5; c969bee716056917c6f4c4a8607cea6b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..300
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>300
FT                   /gene="HLA-DRB1"
FT   mRNA            <1..>300
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>300
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6QJL9"
FT                   /db_xref="IMGT/HLA:DRB1*03:27"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6QJL9"
FT                   /protein_id="AAS47492.1"
FT                   /translation="GDTRPRFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRRVHPKVT"
XX
SQ   Sequence 300 BP; 68 A; 71 C; 106 G; 55 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggagagatac ttccataacc aggaggagaa cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacct cctggagcag aagcggggcc aggtggacaa ttactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc gagtccatcc taaggtgact       300
//