Dbfetch

ID   AY530953; SV 1; linear; genomic DNA; STD; HUM; 2877 BP.
XX
AC   AY530953;
XX
DT   01-MAY-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*030402 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2877
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   "HLA-Cw*030402 allele sequence reveals a 20bp deletion in intron 4";
RL   Unpublished.
XX
RN   [2]
RP   1-2877
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   ;
RL   Submitted (21-JAN-2004) to the INSDC.
RL   Immunogenetics, National Cancer Research Institute, L.Go Rosanna Benzi, 10,
RL   Genova, GE 16132, Italy
XX
DR   MD5; be42038dd5348757a9c683918b1db4f0.
DR   Ensembl-Gn; ENSG00000225691; homo_sapiens.
DR   Ensembl-Tr; ENST00000457903; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2877
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2877
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*030402"
FT   mRNA            join(<1..73,204..473,719..994,1582..1857,1962..2081,
FT                   2521..2553,2661..2708,2873..>2877)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*030402"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,719..994,1582..1857,1962..2081,
FT                   2521..2553,2661..2708,2873..2877)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*030402"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q53YP1"
FT                   /db_xref="IMGT/HLA:C*03:04:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YP1"
FT                   /protein_id="AAS98883.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 2877 BP; 539 A; 824 C; 923 G; 591 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggttggg agggaatcgg cctctgcgga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgctgtgtc       240
     ccggcccggc cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcctcatccc ccacggacgg cccgggtcgc       540
     cccaagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcgggggc ggggccaggg       720
     tctcacatca tccagaggat gtacggctgc gacgtggggc ccgacgggcg cctcctccgc       780
     gggtatgacc agtacgccta cgacggcaag gattacatcg ccctgaacga ggatctgcgc       840
     tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt       900
     gaggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac       960
     ctgaagaatg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1020
     ccatctcctg tagatctccc gggatggcct cccacgagga ggggaggaaa atgggatcag      1080
     cgctagaata tcgccctccc ttgaatggag aatgggatga gttttcctga gtttcctctg      1140
     agggccccct ctgctctcta ggacaattaa gggatgaagt ccttgaggaa atggagggga      1200
     agacagtccc tagaatactg atcaggggtc ccctttgacc actttgacca ctgcagcagc      1260
     tgtggtcagg ctgctgacct ttctctcagg ccttgttctc tgcctcacgc tcaatgtgtt      1320
     tgaaggtttg attccagctt ttctgagtcc ttcggcctcc actcaggtca ggaccagaag      1380
     tcgctgttcc tccctcagag actagaactt tccaatgaat aggagattat cccaggtgcc      1440
     tgtgtccagg ctggcgtctg ggttctgtgc ccccttcccc accccaggtg tcctgtccgt      1500
     tctcaggatg gtcacatggg cgctgttgga gtgtcgcaag agagatacaa agtgtctgaa      1560
     ttttctgact cttcccgtca gaacacccaa agacacacgt gacccaccat cccgtctctg      1620
     accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga      1680
     cctggcagtg ggatggggag gaccaaactc aggacactga gcttgtggag accaggccag      1740
     caggagatgg aaccttccag aagtgggcag ctgtggtggt gccttctgga gaagagcaga      1800
     gatacacgtg ccatgtgcag cacgaggggc tgccggagcc cctcaccctg agatggggta      1860
     aggaggggga tgaggggtca tatctgttct cagggaaagc aggagccctt ctggagccct      1920
     tcagcagggt cagggcccct caccttcccc tcctttccca gagccgtctt cccagcccac      1980
     catccccatc gtgggcatcg ttgctggcct ggctgtcctg gctgtcctag ctgtcctagg      2040
     agctgtggtg gctgttgtga tgtgtaggag gaagagctca ggtagggaag gggtgaggag      2100
     tggggtctgg gttttcttgt tccactggga gtttcaagcc ccaggtagaa gtgtgcccca      2160
     cctcgttact ggaagcacca tccacacatg ggccatccca gcctgggacc ctgtgtgcca      2220
     gcacttactc tgttgtgaag cacatgacaa tgaaggacag atgtatcacc ttgatgatta      2280
     tggtgttggg gtccttgatt ccagcattca tgagtcaggg gaaggtccct gctaaggaca      2340
     gaccttagga gggcagttgc tccagaaccc acagctgctt tccccgtgtt tcctgatcct      2400
     gccctgggtc tgcagtcata gttctggaaa cttctcttgg gtccaagact aggaggttcc      2460
     cctaagatcg catggccctg actcctccct gtcccctcac agggcatttt cttcccacag      2520
     gtggaaaagg agggagctgc tctcaggctg cgtgtaagtg atggcggtgg gcgtgtggag      2580
     gagctcaccc accccataat tcctcttgtc ccacatctcc tgcgggctct gaccaggtct      2640
     ttttttttgt tctaccccag ccagcaacag tgcccagggc tctgatgagt ctctcatcgc      2700
     ttgtaaaggt gagattctgg ggagctgaag tggtcggggg tggggcagag ggaaaaggcc      2760
     taggtaatgg ggatcctttg attgggacgt ttcgaatgtg tggtgagctg ttcagagtgt      2820
     gatcacttac catgactgac ctgaatttgt tcatgactat tgtgttctgt agcctga         2877
//