spacer

EBI Dbfetch

ID   AY523970; SV 1; linear; mRNA; STD; HUM; 2456 BP.
XX
AC   AY523970;
XX
DT   11-MAR-2004 (Rel. 79, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens TAP1 (TAP1) mRNA, TAP1*02 variant allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2456
RA   Tilanus M.G.J., Koene G.J.P.A., Rozemuller E.H., vd Weide P.;
RT   "A new TAP1*02 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-2456
RA   Tilanus M.G.J., Koene G.J.P.A., Rozemuller E.H., vd Weide P.;
RT   ;
RL   Submitted (12-JAN-2004) to the INSDC.
RL   Pathology, University Medical Center, Utrecht, P. O. Box 85500, Utrecht
RL   3508GA, The Netherlands
XX
DR   MD5; b335fedf1a368cf5bd301788f251c9f9.
DR   H-InvDB; HIT000255143_05.4.
DR   H-InvDB; HIT000255143_06.4.
DR   H-InvDB; HIT000255143_07.4.
DR   H-InvDB; HIT000255143_08.4.
DR   H-InvDB; HIT000255143_09.4.
DR   H-InvDB; HIT000255143_10.4.
DR   H-InvDB; HIT000255143_11.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2456
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2456
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT   exon            <1..804
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=1
FT   CDS             207..2453
FT                   /codon_start=1
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /product="TAP1"
FT                   /note="similar to TAP1 in GenBank Accession Number X66401"
FT                   /db_xref="GOA:Q6QWC1"
FT                   /db_xref="H-InvDB:HIT000255143_04.4"
FT                   /db_xref="IMGT/HLA:TAP1*05:01"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005293"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR013305"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6QWC1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAS55411.1"
FT                   /translation="MASSRCPAPRGCRCLPGASLAWLGTVLLLLADWVLLRTALPRIFS
FT                   LLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATVGSKSENAGAQGWLAALKPLAAALG
FT                   LALPGLALFRELISWGAPGSADSTRLPHWGSHPTAFVVSYAAALPAAALWHKLGSLWVP
FT                   GGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSLGEMAIPFFTGRLTDWILQDGSAD
FT                   TFTRNLTLMSILTIASAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQT
FT                   GNIMSRVTEDTSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLVTLPLLFL
FT                   LPKKVGKWYQLLEVQVRESLAKSSQVAIEVLSAMPTVRSFANEEGEAQKFREKLQEIKT
FT                   LNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTSGAVSSGNLVTFVLYQMQFTQAV
FT                   EVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPD
FT                   ILVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRY
FT                   LHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTE
FT                   VGEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSR
FT                   SVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE"
FT   exon            805..919
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=2
FT   exon            920..1050
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=3
FT   exon            1051..1256
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=4
FT   exon            1257..1454
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=5
FT   exon            1455..1583
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=6
FT   exon            1584..1772
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=7
FT   exon            1773..1946
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=8
FT   exon            1947..2109
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=9
FT   exon            2110..2246
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=10
FT   exon            2247..>2456
FT                   /gene="TAP1"
FT                   /allele="TAP1*02 variant"
FT                   /number=11
XX
SQ   Sequence 2456 BP; 471 A; 726 C; 740 G; 519 T; 0 other;
     ccgctttcga tttcgctttc ccctaaatgg ctgagcttct cgccagcgca ggatcagcct        60
     gttcctggga ctttccgaga gccccgccct cgttccctcc cccagccgcc agtaggggag       120
     gactcggcgg tacccggagc ttcaggcccc accggggcgc ggagagtccc aggcccggcc       180
     gggaccggga cggcgtccga gtgccaatgg ctagctctag gtgtcccgct ccccgcgggt       240
     gccgctgcct ccccggagct tctctcgcat ggctggggac agtactgcta cttctcgccg       300
     actgggtgct gctccggacc gcgctgcccc gcatattctc cctgctggtg cccaccgcgc       360
     tgccactgct ccgggtctgg gcggtgggcc tgagccgctg ggccgtgctc tggctggggg       420
     cctgcggggt cctcagggca acggttggct ccaagagcga aaacgcaggt gcccagggct       480
     ggctggctgc tttgaagcca ttagctgcgg cactgggctt ggccctgccg ggacttgcct       540
     tgttccgaga gctgatctca tggggagccc ccgggtccgc ggatagcacc aggctaccgc       600
     actggggaag tcaccctacc gccttcgtcg tcagttatgc agcggcactg cccgcagcag       660
     ccctgtggca caaactcggg agcctctggg tgcccggcgg tcagggcggc tctggaaacc       720
     ctgtgcgtcg gcttctaggc tgcctgggct cggagacgcg ccgcctctcg ctgttcctgg       780
     tcctggtggt cctctcctct cttggggaga tggccattcc attctttacg ggccgcctca       840
     ctgactggat tctacaagat ggctcagccg ataccttcac tcgaaactta actctcatgt       900
     ccattctcac catagccagt gcagtgctgg agttcgtggg tgacgggatc tataacaaca       960
     ccatgggtca cgtgcacagc cacttgcagg gagaggtgtt tggggctgtc ctgcgccagg      1020
     agacggagtt tttccaacag aaccagacag gtaacatcat gtctcgggta acagaggaca      1080
     cgtccaccct gagtgattct ctgagtgaga atctgagctt atttctgtgg tacctggtgc      1140
     gaggcctatg tctcttgggg atcatgctct ggggatcagt gtccctcacc atggtcaccc      1200
     tggtcaccct gcctctgctt ttccttctgc ccaagaaggt gggaaaatgg taccagttgc      1260
     tggaagtgca ggtgcgggaa tctctggcaa agtccagcca ggtggccatt gaggtcctgt      1320
     cggccatgcc tacagttcga agctttgcca acgaggaggg cgaagcccag aagtttaggg      1380
     aaaagctgca agaaataaag acactcaacc agaaggaggc tgtggcctat gcagtcaact      1440
     cctggaccac tagtatttca ggtatgctgc tgaaagtggg aatcctctac attggtgggc      1500
     agctggtgac cagtggggct gtaagcagtg ggaaccttgt cacatttgtt ctctaccaga      1560
     tgcagttcac ccaggctgtg gaggtactgc tctccatcta ccccagagta cagaaggctg      1620
     tgggctcctc agagaaaata tttgagtacc tggaccgcac ccctcgctgc ccacccagtg      1680
     gtctgttgac tcccttacac ttggagggcc ttgtccagtt ccaagatgtc tcctttgcct      1740
     acccaaaccg cccagatatc ttagtgctac aggggctgac attcacccta cgccctggcg      1800
     aggtgacggc gctggtggga cccaatgggt ctgggaagag cacagtggct gccctgctgc      1860
     agaatctgta ccagcccacc gggggacagc tgctgttgga tgggaagccc cttccccaat      1920
     atgagcaccg ctacctgcac aggcaggtgg ctgcagtggg acaagagcca caggtatttg      1980
     gaagaagtct tcaagaaaat attgcctatg gcctgaccca gaagccaact atggaggaaa      2040
     tcacagctgc tgcagtaaag tctggggccc atagtttcat ctctggactc cctcagggct      2100
     atgacacaga ggtaggcgag gctgggagcc agttgtcagg gggtcagcga caggcagtgg      2160
     cgttggcccg agcattgatc cggaaaccat gtgtacttat cctggatgat gccaccagtg      2220
     ccctggatgc aaacagccag ttacaggtgg agcagctcct gtacgaaagc cctgagcggt      2280
     actcccgctc agtgcttctc atcacccagc acctcagcct ggtggagcag gctgaccaca      2340
     tcctctttct ggaaggaggc gctatccggg aggggggaac ccaccagcag ctcatggaga      2400
     aaaaggggtg ctactgggcc atggtgcagg ctcctgcaga tgctccagaa tgaaag          2456
//


spacer
spacer