spacer

EBI Dbfetch

ID   AY518342; SV 1; linear; mRNA; STD; VRT; 2623 BP.
XX
AC   AY518342;
XX
DT   24-MAR-2005 (Rel. 83, Created)
DT   09-NOV-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Oncorhynchus mykiss gill-specific calpain mRNA, complete cds.
XX
KW   .
XX
OS   Oncorhynchus mykiss (rainbow trout)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes;
OC   Salmonidae; Salmoninae; Oncorhynchus.
XX
RN   [1]
RP   1-2623
RX   DOI; 10.1007/s10695-005-0560-2.
RX   PUBMED; 20035473.
RA   Salem M., Rexroad C.E., Yao J.;
RT   "Identification of a novel gill-specific calpain from rainbow trout
RT   (Oncorhynchus mykiss)";
RL   Fish Physiol. Biochem. 32(1):1-6(2006).
XX
RN   [2]
RP   1-2623
RA   Salem M., Yao J.;
RT   ;
RL   Submitted (05-JAN-2004) to the INSDC.
RL   Division of Animal and Veterinary Sciences, West Virginia University,
RL   Morgantown, WV 26506-6108, USA
XX
DR   MD5; 16ea392e8e39ea8c089e1566b7d8152b.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2623
FT                   /organism="Oncorhynchus mykiss"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:8022"
FT   CDS             146..2176
FT                   /codon_start=1
FT                   /product="gill-specific calpain"
FT                   /db_xref="GOA:Q596C5"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR029542"
FT                   /db_xref="UniProtKB/TrEMBL:Q596C5"
FT                   /protein_id="AAS85758.1"
FT                   /translation="MPAKSISTQADGKTFEQLRQECLQKKKLFEDPDFPACDSSLYYSQ
FT                   SVPINFEWKRPGELCENPEFIVGGADRTDICQGALGDCWLLAAIASLTLHKETLARVVP
FT                   NDQGFDRSYAGIFHFQFWQHNRWLDVVVDDRLPAVRNRLVLLHSASNNEFWSALLEKAY
FT                   AKLNGSYESLKGGSTLEAMEDFTGGVGETYETKSAPTDLFNIMKKAYDRGSMMGCSIDI
FT                   TSSAESEAQTASGLVKGHAYSITGLEEVNYRGKKVKLIRIRNPWGQVEWNGAWSDESRE
FT                   WNVIDSSEKKRILQNSMDDGEFWMEFEDFKANYDKIEICNLTPDSLTDDTKRKWEVNMF
FT                   EGNWIRGSTAGGCRNFIDTFWTNPQFKLTLLHADDNNDKCSVVIALMQKNRRALRKEGL
FT                   DLQTIGFALYEAPADEDHLGKDFFRYNGSKARSKTYINVREISERFTLPPGNYLLVPTT
FT                   FQPHDEADFIIRIFSEKAAGTMEMGNTVDADLPDPPMPSLPEEETDEEKGLRRMFEKIA
FT                   GSDQAISARELQQVLNGVLSRRREIKFDGLSLNTCHSIINLMDVDNSGQLEFQEFKVFW
FT                   EKMKKWIMLFISYDTDRSGKMSSYELRIALKAAGMHLNTKLLQLLGLRFADENYDIDFD
FT                   DYLTCIVRLENMFRVFQALDQSKTGQVNMNILQFLLLSMNV"
XX
SQ   Sequence 2623 BP; 709 A; 645 C; 675 G; 594 T; 0 other;
     ccacgcgtcc gaggatttgc aaaacaccca aaaccgctct ctctcccagt ctctgtcact        60
     gctcacaaac aagggacatc tctcccccac acacacacac actgtccttc tcccccaagt       120
     ttccccttta gtctgagccc tcaagatgcc cgccaagtcc atcagcaccc aagcggatgg       180
     gaagacgttt gagcagctga ggcaggagtg tctacagaag aagaaactgt ttgaggaccc       240
     agacttccct gcttgcgact catccctcta ctacagccaa agcgtgccca tcaactttga       300
     atggaagaga cctggggaac tttgtgagaa tcccgaattc atagttggtg gggctgatag       360
     gacagacata tgtcaaggag cactagggga ctgctggctc ctggcggcca ttgcctctct       420
     gaccctccat aaggagaccc tggccagagt ggtgcccaac gaccagggct ttgaccgcag       480
     ctacgccggc atcttccact tccagttctg gcagcacaac agatggctgg acgtggtggt       540
     ggatgaccga ctgcctgctg tgaggaaccg cctggtgctg ctccactctg cctccaacaa       600
     cgagttttgg agcgcactgc tggagaaggc ctatgccaag ttgaacggga gctatgagtc       660
     cctgaaggga ggctctaccc tagaggccat ggaggacttc accggcggcg ttggggagac       720
     gtacgagacc aaaagcgctc caaccgacct cttcaacatc atgaagaagg cctacgacag       780
     aggctcgatg atgggctgct ctatagacat caccagctct gctgagtcag aggcccagac       840
     agcttcagga ctggtaaagg gacacgccta ctccatcaca ggccttgagg aggttaacta       900
     cagagggaaa aaggtcaagc tgatccggat caggaaccct tggggacagg tggaatggaa       960
     cggtgcctgg agtgacgagt ctagggagtg gaatgtaatc gacagttctg agaaaaaacg      1020
     cattcttcag aactccatgg atgatgggga attctggatg gagtttgagg atttcaaggc      1080
     caactacgac aagatagaga tctgcaacct gacgccggac tctctgacgg acgacaccaa      1140
     gcggaagtgg gaggtgaaca tgttcgaggg caactggatc cggggctcca ccgcaggcgg      1200
     ctgcagaaac ttcatagata cattttggac caaccctcag ttcaagctga ccctgctgca      1260
     tgctgacgat aataatgata agtgcagcgt ggtcatcgct ctgatgcaga agaaccgccg      1320
     tgcgctgagg aaagagggtc tggacctgca aaccatcggc tttgctcttt acgaggcccc      1380
     tgcagatgag gaccacctgg ggaaagactt cttccgctac aatgggtcca aggctcgcag      1440
     taagacctac atcaacgtga gggagatctc cgagcgcttc accttgcccc cagggaacta      1500
     cctgctggtg cccaccacct tccagcccca cgacgaggcc gacttcatca tacgcatctt      1560
     ctcggagaag gcagccggaa ccatggagat gggtaacaca gtagatgctg atttgccaga      1620
     tcctccaatg cccagtctac cagaggagga gacggatgag gagaagggac tgaggagaat      1680
     gtttgaaaag attgctggtt cggaccaggc catctctgca agggagcttc agcaggtgtt      1740
     gaatggagta cttagcagga ggagagagat caagtttgac ggtctgagtc tcaacacctg      1800
     ccacagcatc atcaacctga tggatgttga caattccggg cagcttgagt ttcaggagtt      1860
     caaggtcttc tgggaaaaga tgaagaaatg gattatgctc ttcatttctt atgacacgga      1920
     ccggtcaggg aagatgtcct cctatgagct ccgcatagct ctgaaagcag caggcatgca      1980
     tctgaacact aagctcctcc agctgcttgg cttgaggttc gctgacgaga actatgacat      2040
     cgactttgat gactacctca cctgcatcgt ccgcctggaa aatatgttca gggttttcca      2100
     agcattggac caaagcaaga caggtcaggt caacatgaac atactgcagt tcctccttct      2160
     ttccatgaac gtctgaagag gatccagtgg aagaacaaag taaaataacg ggcttggggt      2220
     gcaatatgtg ttgctttgca aatacactaa tatcgagtcg ttcccgctgg gaacgcggtt      2280
     agcggataca ctagttataa ttcatgcata aaacatacgc tatatagtta tagcgtatgt      2340
     tttaacgttg tatgcctttg tctctcttga attcactcaa tagagacatt ttgttttaaa      2400
     acgaaaccaa catacttgtg ccacagtttg gaagttatgc ctcttgtatt tgacaatcag      2460
     ggggatttgt gttcaattct gtttacggag atgctccaat aataaataat gcactgatca      2520
     agtttttaaa gtttcatgtt gacacaccgt ttcagttgat ttctcagttt gggattaaac      2580
     taaataaaaa ttatattatg aaaatgtaaa aaaaaaaaaa aaa                        2623
//


spacer
spacer