spacer

EBI Dbfetch

ID   AY509617; SV 1; linear; genomic DNA; STD; HUM; 1968 BP.
XX
AC   AY509617;
XX
DT   28-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen precursor (HLA-A) gene, HLA-A*3406 allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1968
RA   Robbins F.-M., Adams S., Hackett J., Martin J., Marincola F.;
RT   "Identification of novel HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1968
RA   Robbins F.-M., Adams S., Hackett J., Martin J., Marincola F.;
RT   ;
RL   Submitted (19-DEC-2003) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 93ebc922eadca1a30f3bdc3de9ee2a3c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1968
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="#33041S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1920
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT   mRNA            join(1..127,258..527,769..1044,1645..>1920)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT                   /product="MHC class I antigen precursor"
FT   exon            1..127
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT                   /number=1
FT   5'UTR           1..54
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT   CDS             join(55..127,258..527,769..1044,1645..>1920)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT                   /product="MHC class I antigen precursor"
FT                   /note="HLA-A variant; antigen presenting molecule"
FT                   /db_xref="GOA:Q6R740"
FT                   /db_xref="IMGT/HLA:A*34:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R740"
FT                   /protein_id="AAR99593.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   sig_peptide     55..126
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT   mat_peptide     join(127,258..527,769..1044,1645..>1920)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-A variant; antigen presenting molecule"
FT   exon            258..527
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT                   /number=2
FT   exon            769..1044
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT                   /number=3
FT   exon            1645..1920
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3406"
FT                   /number=4
XX
SQ   Sequence 1968 BP; 370 A; 606 C; 649 G; 343 T; 0 other;
     gttctaaagt ccgcacgcac ccaccgggac tcagattctc cccagacgcc gaggatggcc        60
     gtcatggcgc cccgaaccct cgtcctgcta ctctcggggg ccctggccct gacccagacc       120
     tgggcgggtg agtgcggggt cgggagggaa acggcctctg tggggagaag caaggggccc       180
     gcccggcggg ggcgcaggac ccgggaagcc gcgcctggag gagggtcggg cgggtctcag       240
     ccactcctcg cccccaggct cccactccat gaggtatttc tacacctccg tgtcccggcc       300
     cggccgcggg gagccccgct tcatcgccgt gggctacgtg gacgacacgc agttcgtgcg       360
     gttcgacagc gacgccgcga gccagaggat ggagccgcgg gcgccgtgga tagagcagga       420
     ggggccggag tattgggacc ggaacacacg gaatgtgaag gcccagtcac agactgaccg       480
     agtggacctg gggaccctgc gcggctacta caaccagagc gaggacggtg agtgaccccg       540
     gcccggggcg caggtcacga cccctcatcc cccacggacg ggccaggtcg cccacagtct       600
     ccgggtccga gatccgcccc gaagccgcgg gaccccgaga cccttgcccc gggagaggcc       660
     caggcgcctt tacccggttt cattttcagt ttaggccaaa aatccccccg ggttggtcgg       720
     ggcggggcgg ggctcggggg accgggctga cctcggggtc cgggccaggt tctcacacca       780
     tccagaggat gtatggctgc gacgtggggc cggacgggcg cttcctccgc gggtaccagc       840
     aggacgctta cgacggcaag gattacatcg ccctgaacga ggacctgcgc tcttggaccg       900
     cggcggacat ggcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc       960
     agttgagagc ctacctggag ggcacgtgcg tggagtggct ccgcagatac ctggagaacg      1020
     ggaaggagac gctgcagcgc acgggtacca ggggccacgg ggcgcctccc tgatcgcctg      1080
     tagatctccc gggctggcct cccacaagga ggggagacaa ttgggaccaa cactagaata      1140
     tcgccctccc tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag      1200
     agagtgactc tgaggttccg ccctgctctc tgacacaatt aagggataaa atctctgaag      1260
     gaatgacggg aagacgatcc ctcgaatact gatgagtggt tccctttgac acacaccggc      1320
     agcagccttg ggcccgtgac ttttcctctc aggccttgtt ctctgcttca cactcaatgt      1380
     gtgtgggggt ctgagtccag cacttctgag tccctcagcc tccactcagg tcaggaccag      1440
     aagtcgctgt tccctcttca gggactagaa ttttccacgg aataggagat tatcccaggt      1500
     gcctgtgtcc aggctggtgt ctgggttctg tgctcccttc cccatcccag gtgtcctgtc      1560
     cattctcaag atagccacat gtgtgctgga ggagtgtccc atgacagatg caaaatgcct      1620
     gaatgttctg actcttcctg acagacgccc ccaagacgca tatgactcac cacgctgtct      1680
     ctgaccatga ggccaccctg aggtgctggg ccctgagctt ctaccctgcg gagatcacac      1740
     tgacctggca gcgggatggg gaggaccaga cccaggacac ggagctcgtg gagaccaggc      1800
     ctgcagggga tgggaccttc cagaagtggg cgtctgtggt ggtgccttct ggacaggagc      1860
     agagatacac ctgccatgtg cagcatgagg gtctgcccaa gcccctcacc ctgagatggg      1920
     gtaaggaggg agacgggggt gtcatgtctt ttagggaaag caggagcc                   1968
//


spacer
spacer