spacer

EBI Dbfetch

ID   AY509616; SV 1; linear; genomic DNA; STD; HUM; 2068 BP.
XX
AC   AY509616;
XX
DT   28-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen precursor (HLA-A) gene, HLA-A*0269 allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2068
RA   Robbins F.-M., Adams S., Chun H., Martin J., Marincola F.;
RT   "Identification of novel HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-2068
RA   Robbins F.-M., Adams S., Chun H., Martin J., Marincola F.;
RT   ;
RL   Submitted (19-DEC-2003) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 1db553dfe28500f092e45ef38347427e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2068
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="#34617S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>2000
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT   mRNA            join(1..227,358..627,869..1144,1745..>2000)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT                   /product="MHC class I antigen precursor"
FT   exon            1..227
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT                   /number=1
FT   5'UTR           1..154
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT   CDS             join(155..227,358..627,869..1144,1745..>2000)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT                   /product="MHC class I antigen precursor"
FT                   /note="HLA-A variant; antigen presenting molecule"
FT                   /db_xref="GOA:Q6R741"
FT                   /db_xref="IMGT/HLA:A*02:69"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R741"
FT                   /protein_id="AAR99592.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLP"
FT   sig_peptide     155..226
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT   mat_peptide     join(227,358..627,869..1144,1745..>2000)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-A variant; antigen presenting molecule"
FT   exon            358..627
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT                   /number=2
FT   exon            869..1144
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT                   /number=3
FT   exon            1745..2000
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0269"
FT                   /number=4
XX
SQ   Sequence 2068 BP; 396 A; 626 C; 672 G; 374 T; 0 other;
     gtagggtcct tcttcctgga tactcacgac gcggacccag ttctcactcc cattgggtgt        60
     cgggtttcca gagaagccaa tcagtgtcgt cgcggtcgcg gttctaaagt ccgcacgcac       120
     ccaccgggac tcagattctc cccagacgcc gaggatggcc gtcatggcgc cccgaaccct       180
     cgtcctgcta ctctcggggg ctctggccct gacccagacc tgggcgggtg agtgcggggt       240
     cgggagggaa acggcctctg tggggagaag caacgggccc gcctggcggg ggcgcaggac       300
     ccgggaagcc gcgccgggag gagggtcggg cgggtctcag ccactcctcg tccccaggct       360
     ctcactccat gaggtatttc ttcacatccg tgtcccggcc cggccgcggg gagccccgct       420
     tcatcgcagt gggctacgtg gacgacacgc agttcgtgcg gttcgacagc gacgccgcga       480
     gccagaggat ggagccgcgg gcgccgtgga tagagcagga gggtccggag tattgggacg       540
     gggagacacg gaaagtgaag gcccactcac agattgaccg agtggacctg gggaccctgc       600
     gcggctacta caaccagagc gaggccggtg agtgaccccg gcccggggcg caggtcacga       660
     cctctcatcc cccacggacg ggccaggtcg cccacagtct ccgggtccga gatccgcccc       720
     gaagccgcgg gaccccgaga cccttgcccc gggagaggcc caggcgcctt tacccggttt       780
     cattttcagt ttaggccaaa aatcccccca ggttggtcgg ggcggggcgg ggctcggggg       840
     accgggctga ccgcggggtc cgggccaggt tctcacaccg tccagaggat gtatggctgc       900
     gacgtggggt cggactggcg cttcctccgc gggtaccacc agtacgccta cgacggcaag       960
     gattacatcg ccctgaaaga ggacctgcgc tcttggaccg cggcggacat ggcagctcag      1020
     accaccaagc acaagtggga ggcggcccat gtggcggagc agttgagagc ctacctggag      1080
     ggcacgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc      1140
     acgggtacca ggggccacgg ggcgcctccc tgatcgcctg tagatctccc gggctggcct      1200
     cccacaagga ggggagacaa ttgggaccaa cactagaata tcgccctccc tctggtcctg      1260
     agggagagga atcctcctgg gtttccagat cctgtaccag agagtgactc tgaggttccg      1320
     ccctgctctc tgacacaatt aagggataaa atctctgaag gaatgacggg aagacgatcc      1380
     ctcgaatact gatgagtggt tccctttgac acacacaggc agcagccttg ggcccgtgac      1440
     ttttcctctc aggccttgtt ctctgcttca cactcaatgt gtgtgggggt ctgagtccag      1500
     cacttctgag tccctcagcc tccactcagg tcaggaccag aagtcgctgt tccctcttca      1560
     gggactagaa ttttccacgg aataggagat tatcccaggt gcctgtgtcc aggctggtgt      1620
     ctgggttctg tgctcccttc cccatcccag gtgtcctgtc cattctcaag atagccacat      1680
     gtgtgctgga ggagtgtccc atgacagatg caaaatgcct gaatgatctg actcttcctg      1740
     acagacgccc ccaaaacgca tatgactcac cacgctgtct ctgaccatga agccaccctg      1800
     aggtgctggg ccctgagctt ctaccctgcg gagatcacac tgacctggca gcgggatggg      1860
     gaggaccaga cccaggacac ggagctcgtg gagaccaggc ctgcagggga tggaaccttc      1920
     cagaagtggg tggctgtggt ggtgccttct ggacaggagc agagatacac ctgccatgtg      1980
     cagcatgagg gtttgcccaa gcccctcacc ctgagatggg gtaaggaggg agacgggggt      2040
     gtcatgtctt ttagggaaag caggagcc                                         2068
//


spacer
spacer