spacer

EBI Dbfetch

ID   AY509615; SV 1; linear; genomic DNA; STD; HUM; 3069 BP.
XX
AC   AY509615;
XX
DT   28-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen precursor (HLA-Cw) gene, HLA-Cw*0726
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3069
RA   Robbins F.-M., Adams S., Chen D., Young N., Stroncek D.;
RT   "Identification of novel HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3069
RA   Robbins F.-M., Adams S., Chen D., Young N., Stroncek D.;
RT   ;
RL   Submitted (19-DEC-2003) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 705cb7c1e6112114a894aab34b391fdf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3069
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="#24973S"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>3069
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT   mRNA            join(1..198,329..598,849..1124,1712..1987,2112..2231,
FT                   2672..2704,2812..2859,3024..>3069)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /product="MHC class I antigen precursor"
FT   exon            1..198
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=1
FT   5'UTR           1..125
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT   CDS             join(126..198,329..598,849..1124,1712..1987,2112..2231,
FT                   2672..2704,2812..2859,3024..3028)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /product="MHC class I antigen precursor"
FT                   /note="HLA-Cw*07 variant; antigen presenting molecule"
FT                   /db_xref="GOA:Q6R742"
FT                   /db_xref="IMGT/HLA:C*07:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R742"
FT                   /protein_id="AAR99591.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   sig_peptide     126..197
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT   mat_peptide     join(198,329..598,849..1124,1712..1987,2112..2231,
FT                   2672..2704,2812..2859,3024..3025)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-Cw*07 variant; antigen presenting molecule"
FT   exon            329..598
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=2
FT   exon            849..1124
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=3
FT   exon            1712..1987
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=4
FT   exon            2112..2231
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=5
FT   exon            2672..2704
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=6
FT   exon            2812..2859
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=7
FT   exon            3024..>3069
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
FT                   /number=8
FT   3'UTR           3029..>3069
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0726"
XX
SQ   Sequence 3069 BP; 576 A; 903 C; 962 G; 628 T; 0 other;
     gacgcgtccc caattcccac tcccattggg tgtcgggttc tagagaagcc aatcagcgtc        60
     tccgcagtcc cggttctaaa gtccccagtc acccacccgg actcacattc tccccagagg       120
     ccgagatgcg ggtcatggcg ccccgagccc tcctcctgct gctctcggga ggcctggccc       180
     tgaccgagac ctgggcctgt gagtgcgggg ttgggaggga agcggcctct gcggagagga       240
     gcgaggggcc cgcccggcga gggcgcagga cccggggagc cgcgcaggga ggtgggtcgg       300
     gcgggtctca gcccctcctc gcccccaggc tcccactcca tgaggtattt ctacaccgcc       360
     gtgtcccggc ccggccgcgg agagccccgc ttcatctcag tgggctacgt ggacgacacg       420
     cagttcgtgc ggttcgacag cgacgccgcg agtccgagag gggagccgcg ggcgccgtgg       480
     gtggagcagg aggggccgga gtattgggac cgggagacac agaactacaa gcgccaggca       540
     caggctgacc gagtgagcct gcggaacctg cgcggctact acaaccagag cgaggacggt       600
     gagtgacccc ggcccggggc gcaggtcacg acccctcccc atcccccacg gacggcccgg       660
     gtcgccccga gtctccccgt ctgagatcca ccccaaggtg gatctgcgga acccgcccag       720
     accctcgacc ggagagagcc ccagtcgcct ttacccggtt tcattttcgg tttaggccaa       780
     aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg actgggctga ccgcgggggc       840
     ggggccaggg tctcacaccc tccagaggat gtatggctgc gacctggggc ccgacgggcg       900
     cctcctccgc gggtatgacc agtccgccta cgacggcaag gattacatcg ccctgaacga       960
     ggacctgcgc tcctggaccg ccgcggacac cgcggctcag atcacccagc gcaagttgga      1020
     ggcggcccgt gcggcggagc agctgagagc ctacctggag ggcacgtgcg tggagtggct      1080
     ccgcagatac ctggagaacg ggaaggagac gctgcagcgc gcaggtacca ggggcagtgg      1140
     ggagccttcc ccatctccta tagatctccc gggatggcct cccacgagga ggggaggaaa      1200
     atgggatcag cactggaata tcgccctccc ttgaatggag aatggcatga gttttcctga      1260
     gtttcctctg agggccccct ctgctctcta ggacaattaa gggatgaagt ctctgaggaa      1320
     atggagggga agacagtccc tggaatactg atcaggggtc tcctttgacc actttgacca      1380
     ctgcagcagc tgtggtcagg ctgctgacct ttctctcagg ccttgttctc tgcctcatac      1440
     tcaatgtgtc tgaaggtttg attccagctt ttctgagtcc tgcagcctcc actcaggtca      1500
     ggaccagaag tcgctgttcc tccctcagag actagaactt tccaatgaat aggagattat      1560
     cccaggtgcc tgtgtccagg ctggcgtctg ggttctgtgc cgccttcccc accccaggtg      1620
     tcctgtccat tctcaggatg gtcacatggg cgctgctgga gtgtcccaag agagatgcaa      1680
     agtgtctgaa ttttctgact cttcccgtca gaacccccaa agacacacgt gacccaccac      1740
     cccctctctg accatgaggc caccctgagg tgctgggccc tgggcttcta ccctgcggag      1800
     atcacactga cctggcagcg ggatggggag gaccagaccc aggacaccga gcttgtggag      1860
     accaggccag caggagatgg aaccttccag aagtgggcag ctgtggtggt gccttctgga      1920
     caagagcaga gatacacgtg ccatatgcag cacgaggggc tgcaagagcc cctcaccctg      1980
     agctggggta aggaggggaa tggggggtca catctcttat cagagaaagc agaagtcctt      2040
     ctggagccct tcagccgggt cagggctgag gcttgggggt cagggcccct caccttctcc      2100
     tcctttccca gagccatctt cccagcccac catccccatc atgggcatcg ttgctggcct      2160
     ggctgtcctg gttgtcctag ctgtccttgg agctgtggtc accgctatga tgtgtaggag      2220
     gaagagctca ggtagggaag gggtgaagag cggggtctgg gttttcttgt cccactggga      2280
     gtttcaagcc ccaggtagaa gtgtgccccg ccttgttact ggaagcacca tccacacatg      2340
     ggccatccca gcctgggacc ctgtgtgcca gcacttactc ttttgtgaag cacatgtgac      2400
     aatgaaggac ggatgtatca ccttgatgat tatggtgttg gggtcctgat tccagcattc      2460
     atgagtcagg ggaaggtccc tgctaaggac agaccttagg agggcagttg gtccagaacc      2520
     cacaactgct ttccccatgt ttcctgatcc tgccctgggt ctgcagtcgt agttctggaa      2580
     acttctcttg ggtccaagac taggaggttc ccctaaaatc acatggccct gcctcctccc      2640
     agtcccctca tagggcattt tcttcccaca ggtggaaaag gagggagctg ctctcaggct      2700
     gcgtgtaagt gatggcggcg ggcgtgtgga ggagctcacc tactccataa ttcctcttgt      2760
     cccacatctc ctgcgggctc tgaccaggtc tttttttttg ttctacccca ggcagcaaca      2820
     gtgcccaggg ctctgatgag tctctcatca cttgtaaagg tgagattctg gggagctgaa      2880
     gtggtcgggg gtggggcaga gggaaaaggc ctgggtaatg gggattcttt gattgggacg      2940
     tttcgagtgt gtggtgggcc gttcagaatg tcatcactta ccatgactga cctgaatttg      3000
     ttcatgacta ttgtgttctg tagcctgaga cagctgcctg tgtgggactg agatgcagga      3060
     tttcttcac                                                              3069
//


spacer
spacer