Dbfetch

ID   AY509614; SV 1; linear; genomic DNA; STD; HUM; 3059 BP.
XX
AC   AY509614;
XX
DT   28-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen precursor (HLA-Cw) gene, HLA-Cw*0508
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3059
RA   Robbins F.-M., Adams S., Barracchini K., Gress R., Stroncek D.;
RT   "Identification of novel HLA class I alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-3059
RA   Robbins F.-M., Adams S., Barracchini K., Gress R., Stroncek D.;
RT   ;
RL   Submitted (19-DEC-2003) to the INSDC.
RL   Transfusion Medicine, NIH, CC, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 1560938f348bbf8027a77fe08ce4b46f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3059
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="#30393Sb"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..>3059
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT   mRNA            join(1..198,329..598,845..1120,1708..1983,2105..2242,
FT                   2664..2696,2804..2851,3016..>3059)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /product="MHC class I antigen precursor"
FT   exon            1..198
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=1
FT   5'UTR           1..125
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT   CDS             join(126..198,329..598,845..1120,1708..1983,2105..2242,
FT                   2664..2696,2804..2851,3016..3020)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /product="MHC class I antigen precursor"
FT                   /note="HLA Cw*05 variant; antigen presenting molecule"
FT                   /db_xref="GOA:Q6R743"
FT                   /db_xref="IMGT/HLA:C*05:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R743"
FT                   /protein_id="AAR99590.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRK
FT                   LRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWGPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGR
FT                   EGVRSGKGGSCSQAASSNSAQGSDESLIACKA"
FT   sig_peptide     126..197
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT   mat_peptide     join(198,329..598,845..1120,1708..1983,2105..2242,
FT                   2664..2696,2804..2851,3016..3017)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /product="MHC class I antigen"
FT                   /note="HLA Cw*05 variant; antigen presenting molecule"
FT   exon            329..598
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=2
FT   exon            845..1120
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=3
FT   exon            1708..1983
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=4
FT   exon            2105..2242
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=5
FT   exon            2664..2696
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=6
FT   exon            2804..2851
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=7
FT   exon            3016..>3059
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
FT                   /number=8
FT   3'UTR           3021..>3059
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0508"
XX
SQ   Sequence 3059 BP; 580 A; 888 C; 965 G; 626 T; 0 other;
     gacgcgtccc caattcccac tcccattggg tgtcgggttc tagagaagcc aatcagcgtc        60
     tccgcagtcc cggttctaaa gtccccagtc acccacccgg actcggattc tccccagacg       120
     ccgagatgcg ggtcatggcg ccccgaaccc tcatcctgct gctctcggga gccctggccc       180
     tgaccgagac ctgggcctgt gagtgcgagg ttgggaggga aacggcctct gcggagagga       240
     gcgaggggcc cgcccggcga gggcgcagga cccggggagc cgcgcaggga ggagggtcgg       300
     gcgggtctca gcccctcctc gcccccaggc tcccactcca tgaggtattt ctacaccgcc       360
     gtgtcccggc ccggccgcgg agagccccgc ttcatcgcag tgggctacgt ggacgacacg       420
     cagttcgtgc agttcgacag cgacgccgcg agtccaagag gggagccgcg ggcgccgtgg       480
     gtggagcagg aggggccgga gtattgggac cgggagacac agaagtacaa gcgccaggca       540
     cagactgacc gagtgaacct gcggaaactg cgcggctact acaaccagag cgaggccggt       600
     gagtgacccc ggcccggggc gcaggtcacg acccctcccc atcccccacg gacggcccgg       660
     gtcgccccga gtctcccggt ctgagatcca ccccgaggct gcggaacccg cccagaccct       720
     cgaccggaga gagccccagt cacctttacc cggtttcatt ttcagtttag gccaaaatcc       780
     ccgcgggttg gtcggggctg gggcggggct cgggggacgg ggctgaccac gggggcgggg       840
     ccagggtctc acaccctcca gaggatgtat ggctgcgacc tggggcccga cgggcgcctc       900
     ctccgcgggt ataaccagtt cgcctacgac ggcaaggatt acatcgccct gaatgaggac       960
     ctgcgctcct ggaccgccgc ggacaaggcg gctcagatca cccagcgcaa gtgggaggcg      1020
     gcccgtgagg cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc      1080
     agatacctgg agaacgggaa gaagacgctg cagcgcgcgg gtaccagggg cagtggggag      1140
     ccttccccat ctcctgtaga tctcccggga tggcctccca cgaggagggg aggaaaatgg      1200
     gatcagcgct ggaatatcgc cctcccttga atggagaatg ggatgagttt tcctgagttt      1260
     cttctgaggg ccccctctgc tctctaggac aattaaggga tgaagtcctt gaggaaatgg      1320
     aggggaagac agtccctgga atactgatca ggggtcccct ttgaccactt tgaccactgc      1380
     agcagctgtg gtcaggctgc tgacctttct ctcaggcctt gttctctgcc tcacgctcaa      1440
     tgtgtttaaa ggtttgattc cagcttttct gagtccttcg gcctccactc aggtcaggac      1500
     cagaagtcgc tgttcctccc tcagagacta gaactttcca atgaatagga gattatccca      1560
     ggtgcctgtg tccaggctgg cgtctgggtt ctgtgccccc ttccccaccc caggtgtcct      1620
     gtccattctc aggatggtca catgggcact gttggagtgt cgcaagagag atacaaagtg      1680
     tctgaatttt ctgactcttc ccgtcagaac acccaaagac acacgtgacc caccatcccg      1740
     tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca      1800
     cactgacctg gcagcgggat ggcgaggacc aaactcagga caccgagctt gtggagacca      1860
     ggccagcagg agatggaacc ttccagaagt gggcagctgt ggtggtgcct tctggagaag      1920
     agcagagata cacgtgccat gtgcagcacg aggggctgcc agagcccctc accctgagat      1980
     ggggtaagga gggggatgag gggtcatgtg tcttctcagg gaaagcagaa gtcctggagc      2040
     ccttcagccg ggtcagggct gaggcttggg ggtcagggcc cctcaccttc ccctcctttc      2100
     ccagggccat cttcccagcc caccatcccc atcgtgggca tcgttgctgg cctggctgtc      2160
     ctggctgtcc tagctgtcct aggagctgtg atggctgttg tgatgtgtag gaggaagagc      2220
     tcaggtaggg aaggggtgag gagtggggtc tgggttttct tgtcccactg ggagtttcaa      2280
     gccccaggta gaagtgtgcc ccacctcgtt actggaagca ccatccacac atgggccatc      2340
     ccagcctggg accctgtgtg ctagcactta ctctgttgtg aagcacatga caatgaagga      2400
     cagatgtatc accttgatga ttatggtgtt ggggtccttg attccagcat tcatgagtca      2460
     ggggaaggtc cctgctaagg acagacctta ggagggcagt tgctccagaa cccacagctg      2520
     ctttccccgt gtttcctgat cctgccctgg gtctgcagtc atagttctgg aaacttctct      2580
     tgggtccaag actaggaggt tcccctaaga tcgcatggcc ctgcctcctc cctgtcccct      2640
     cacagggcat tttcttccca caggtggaaa aggagggagc tgctctcagg ctgcgtgtaa      2700
     gtgatggcgg tgggcgtgtg gaggagctca cccaccccat aattcctctt gtcccacatc      2760
     tcctgcgggc tctgaccagg tctttttttt tgttctaccc cagccagcaa cagtgcccag      2820
     ggctctgatg agtctctcat cgcttgtaaa ggtgagattc tggggagctg aagtggtcgg      2880
     gggtggggca gagggaaaag gcctaggtaa tggggatcct ttgattggga cgtttcgaat      2940
     gtgtggtgag ctgttcagag tgtcatcact taccatgact gacctgaatt tgttcatgac      3000
     tattgtgttc tgtagcctga gacagctgcc tgtgtgggac tgagatgcag gatttcttc       3059
//