spacer

EBI Dbfetch

ID   AY505490; SV 1; linear; genomic DNA; STD; HUM; 1159 BP.
XX
AC   AY505490;
XX
DT   14-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*13XX allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1159
RX   DOI; 10.1111/j.1399-0039.2006.00669.x.
RX   PUBMED; 17026471.
RA   Chen Q., Zou H., Xu X.H., Luo M., Wang J., Zuo Y.Q., Chen Y.H., Chen X.H.,
RA   Chen X.L., Yao Z.Q., Song N., Zeng J., Mi X.Y., Sun S.X., Wang J.X.,
RA   Zhao T.M.;
RT   "Characterization of HLA-B*5516, -B*1313, -B*9512, and -DRB1*1457 alleles
RT   identified in a southwest Chinese population";
RL   Tissue Antigens 68(4):339-343(2006).
XX
RN   [2]
RP   1-1159
RA   Chen Q., Wang J., Sun S., Zou H., Zeng J., Xu X., Mi X., Chen X., Chen X.,
RA   Chen Y., Song N., Yao Z., Zhao T.M.;
RT   "Identification of a novel allele HLA-B*13XX in a Chinese potential bone
RT   marrow donor";
RL   Unpublished.
XX
RN   [3]
RP   1-1159
RA   Chen Q., Wang J., Sun S., Zou H., Zeng J., Xu X., Mi X., Chen X., Chen X.,
RA   Chen Y., Song N., Yao Z., Zhao T.M.;
RT   ;
RL   Submitted (16-DEC-2003) to the INSDC.
RL   MCIGS, NIAID, National Institutes of Health, 50 South Drive, Room 5516,
RL   Bethesda, MD 20892, USA
XX
DR   MD5; b73c752addf8bf9d98313f950f50c534.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1159
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="CHD1144"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1159
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13XX"
FT                   /note="HLA-B*1301 variant allele"
FT   mRNA            join(1..135,265..534,780..>1055)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13XX"
FT                   /product="MHC class I antigen"
FT   exon            1..135
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13XX"
FT                   /number=1
FT   5'UTR           1..62
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13XX"
FT   CDS             join(63..135,265..534,780..>1055)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13XX"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen; antigen presenting
FT                   molecule"
FT                   /db_xref="GOA:Q6RBY3"
FT                   /db_xref="IMGT/HLA:B*13:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RBY3"
FT                   /protein_id="AAR89903.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRA"
FT   exon            265..534
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13XX"
FT                   /number=2
FT   exon            780..1055
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13XX"
FT                   /number=3
XX
SQ   Sequence 1159 BP; 207 A; 383 C; 415 G; 154 T; 0 other;
     ggggtcccag ttctaaagtc cccacgcacc cacccggact cagaatctcc tcagacgccg        60
     agatgcgggt cacggcgccc cgaaccctcc tcctgctgct ctggggggca gtggccctga       120
     ccgagacctg ggccggtgag tgcgggatcg ggagggaaat ggcctctgtg gggaggagcg       180
     aggggaccgc aggcgggggc gcaggacccg gggagccgcg ccgggaggag ggtctggcgg       240
     gtctcagccc ctcctggccc ccaggctccc actccatgag gtatttctac accgccatgt       300
     cccggcccgg ccgcggggag ccccgcttca tcaccgtggg ctacgtggac gacacccagt       360
     tcgtgaggtt cgacagcgac gccacgagtc cgaggatggc gccccgggcg ccatggatag       420
     agcaggaggg gccggagtat tgggaccggg agacacagat ctccaagacc aacacacaga       480
     cttaccgaga gaacctgcgc accgcgctcc gctactacaa ccagagcgag gccggtgagt       540
     gaccccggcc cggggcgcag gtcacgactc cccatccccc acggacggcc cgggtcgccc       600
     cgagtctccg ggtccgagat ccgcctccct gaggccgcgg gacccgccca gaccctcgac       660
     cggcgagagc cccaggcgcg tttacccggt ttcattttca gttgaggcca aaatccccgc       720
     gggttggtcg gggcggggcg gggctcgggg gacggggctg accgcggggc cggggccagg       780
     gtctcacatc atccagagga tgtatggctg cgacctgggg ccggacgggc gcctcctccg       840
     cgggcataac cagtacgcct acgacggcaa ggattacatc gccctgaacg aggacctgag       900
     ctcctggacc gcggcggaca ccgcggctca gatcacccag ctcaagtggg aggcggcccg       960
     tgtggcggag cagctgagag cctacctgga gggcgagtgc gtggagtggc tccgcagata      1020
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1080
     cccatctcct ataggtcgcc ggggatggcc tcccacgaga agaggaggaa aatgggatca      1140
     gcgctagaat gtcgccctc                                                   1159
//


spacer
spacer