spacer

EBI Dbfetch

ID   AY504815; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY504815;
XX
DT   25-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1-DRB1*0804
DE   variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Moraes M.E., Gouvea N., Romero M., Salomao I., Moraes J.R.;
RT   "Novel HLA-DRB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Moraes M.E., Gouvea N., Romero M., Salomao I., Moraes J.R.;
RT   ;
RL   Submitted (12-DEC-2003) to the INSDC.
RL   Laboratorio de Imunogenetica, Instituto Nacional do Cancer Rua Sacadura
RL   Cabral 178, 4 andar, anexo IV, Rio de Janeiro 20221-903, Brazil
XX
DR   MD5; 000c77bbeaabe5c0039092fe48387e68.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0804 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0804 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0804 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6RCP7"
FT                   /db_xref="IMGT/HLA:DRB1*08:28"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RCP7"
FT                   /protein_id="AAR98646.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 62 C; 97 G; 54 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer