Dbfetch

ID   AY504814; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY504814;
XX
DT   25-JAN-2004 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1-DRB1*0418
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lazaro A.M., Tang T., Hurley C.K.;
RT   "Novel HLA-DRB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Lazaro A.M., Tang T., Hurley C.K.;
RT   ;
RL   Submitted (12-DEC-2003) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Road, NW, Washington, DC
RL   20057, USA
XX
DR   MD5; 6eb30f8234088d1bdd546fa7bd508d36.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0418"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0418"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*0418"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6RCP8"
FT                   /db_xref="IMGT/HLA:DRB1*04:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RCP8"
FT                   /protein_id="AAR98645.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDRRALVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 61 A; 64 C; 96 G; 49 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//