Dbfetch

ID   AY465114; SV 1; linear; genomic DNA; STD; HUM; 357 BP.
XX
AC   AY465114;
XX
DT   17-DEC-2003 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens clone DEL196-DR9V MHC class II antigen (HLA-DRB1) gene, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-357
RX   DOI; 10.1111/j.0001-2815.2004.00252.x.
RX   PUBMED; 15191532.
RA   Liu C.J., Chu C.C., Lee Y.J., Shi Y.N., Lin M.;
RT   "Identification of two novel HLA-DRB1 alleles, DRB1*0903 and DRB1*1145";
RL   Tissue Antigens 64(1):99-101(2004).
XX
RN   [2]
RP   1-357
RA   Liu C.J., Chu C.C., Shih Y.N.;
RT   "A novel DRB1 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-357
RA   Liu C.J., Chu C.C., Shih Y.N.;
RT   ;
RL   Submitted (13-NOV-2003) to the INSDC.
RL   Department of Oral and Maxillofacial Surgery, Mackay Memorial Hospital, No
RL   92 Sec 2 Chung San North Road, Taipei 104, Taiwan
XX
DR   MD5; 81e93a8f5623ca4ce9fb8a2b194e6f26.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..357
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="DEL196-DR9V"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>357
FT                   /gene="HLA-DRB1"
FT   mRNA            <66..>335
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <66..>335
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6S5I0"
FT                   /db_xref="IMGT/HLA:DRB1*09:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6S5I0"
FT                   /protein_id="AAR28666.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLEDRRAEVDTVCRHNYGVGESFTVQRR"
FT   exon            66..335
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 357 BP; 71 A; 88 C; 131 G; 67 T; 0 other;
     tggcgtctct gttagtgtct tccccggagg ccgcccctgt gaccggatcc ttcgtgtccc        60
     cacagcacgt ttcttgaagc aggataagtt tgagtgtcat ttcttcaacg ggacggagcg       120
     ggtgcggtat ctgcacagag gcatctataa ccaagaggag aacgtgcgct tcgacagcga       180
     cgtgggggag taccgggcgg tgacggagct ggggcggcct gtcgccgagt cctggaacag       240
     ccagaaggac ttcctggaag acaggcgcgc cgaggtggac accgtgtgca gacacaacta       300
     cggggttggt gagagcttca cagtgcagag gcgaggtaag catggtgggg ggcgggg          357
//