spacer

EBI Dbfetch

ID   AY457037; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY457037;
XX
DT   24-NOV-2003 (Rel. 77, Created)
DT   21-JUL-2010 (Rel. 105, Last updated, Version 7)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB5) gene, HLA-DRB5*010101 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2006.00588.x.
RX   PUBMED; 16671952.
RA   Garino E., Berrino M., Bertinetto F., Caropreso P., Chidichimo R.,
RA   Dametto E., Fasano M.E., Frisaldi E., Mazzola G., Tondat F., Boccadoro M.,
RA   Bruno B., Amoroso A.;
RT   "Identification of a new allele, HLA-DRB5*0113, through three different
RT   molecular biology techniques";
RL   Tissue Antigens 67(5):427-429(2006).
XX
RN   [2]
RP   1-270
RA   Garino E., Berrino M., Bertola L., Caropreso P., Chidichimo R.,
RA   Dall'Omo A.M., Dametto E., Fasano M.E., Frisaldi E., Mazzola G., Tondat F.,
RA   Boccadoro M., Bruno B., Curtoni E.S.;
RT   ;
RL   Submitted (04-NOV-2003) to the INSDC.
RL   Dept. of Genetic, Biology and Biochemistry, University of Turin, Via
RL   Santena, 19, Turin 10126, Italy
XX
RN   [3]
RC   Sequence update by submitter
RP   1-270
RA   Garino E., Berrino M., Bertola L., Caropreso P., Chidichimo R.,
RA   Dall'Omo A.M., Dametto E., Fasano M.E., Frisaldi E., Mazzola G., Tondat F.,
RA   Boccadoro M., Bruno B., Curtoni E.S.;
RT   ;
RL   Submitted (21-JAN-2004) to the INSDC.
RL   Dept. of Genetic, Biology and Biochemistry, University of Turin, Via
RL   Santena, 19, Turin 10126, Italy
XX
DR   MD5; 648ce9cb06ecac79729701e17b253d99.
DR   Ensembl-Gn; ENSG00000198502; homo_sapiens.
DR   Ensembl-Tr; ENST00000374975; homo_sapiens.
XX
CC   On Jan 21, 2004 this sequence version replaced gi:38426807.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3-p21.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*010101 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*010101 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*010101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q30154"
FT                   /db_xref="HGNC:HGNC:4953"
FT                   /db_xref="IMGT/HLA:DRB5*01:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1FV1"
FT                   /db_xref="PDB:1H15"
FT                   /db_xref="PDB:1HQR"
FT                   /db_xref="PDB:1ZGL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30154"
FT                   /protein_id="AAR20446.2"
FT                   /translation="RFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB5"
FT                   /allele="HLA-DRB5*010101 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 63 A; 63 C; 97 G; 47 T; 0 other;
     cacgtttctt gcagcaggat aagtatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgca cagagacatc tataaccaag aggaggactt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer