Dbfetch

ID   AY445028; SV 1; linear; genomic DNA; STD; HUM; 1857 BP.
XX
AC   AY445028;
XX
DT   18-NOV-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3547 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1857
RA   Avergas C.U., Iglehart B.A., Leffell M.S.;
RT   "Identification of a Novel HLA-B*3547 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1857
RA   Avergas C.U., Iglehart B.A., Leffell M.S.;
RT   ;
RL   Submitted (22-OCT-2003) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 591f98be05f9ae4dbb6cc12e7d45b6cb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1857
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1857
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3547"
FT   mRNA            join(<54..323,569..844,1420..1695,1800..>1857)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3547"
FT                   /product="MHC class I antigen"
FT   CDS             join(<54..323,569..844,1420..1695,1800..>1857)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3547"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*35:47"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6SZ68"
FT                   /protein_id="AAR15394.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTI
FT                   PIVGIVAGLAVL"
FT   exon            54..323
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3547"
FT                   /number=2
FT   exon            569..844
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3547"
FT                   /number=3
FT   exon            1420..1695
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3547"
FT                   /number=4
FT   exon            1800..>1857
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3547"
FT                   /number=5
XX
SQ   Sequence 1857 BP; 355 A; 584 C; 582 G; 336 T; 0 other;
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc caggctccca        60
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       120
     cgcagtgggc tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccacgagtcc       180
     gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt gggaccggaa       240
     cacacagatc ttcaagacca acacacagac ttaccgagag agcctgcgga acctgcgcgg       300
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc       360
     ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcctccctg       420
     aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt ttacccggtt       480
     tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg       540
     acggggctga ccgcggggcc ggggccaggg tctcacatca tccagaggat gtatggctgc       600
     gacctggggc ccgacgggcg cctcctccgc gggcatgacc agtccgccta cgacggcaag       660
     gattacatcg ccctgaacga ggacctgagc tcctggaccg cggcggacac cgcggctcag       720
     atcacccagc gcaagtggga ggcggcccgt gtggcggagc agctgagagc ctacctggag       780
     ggcctgtgcg tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc       840
     gcgggtacca ggggcagtgg ggagccttcc ccatctccta taggtcgccg gggatggcct       900
     cccacgagaa gaggaggaaa atgggatcag cgctagaatg tcgccctccc ttgaatggag       960
     aatggcatga gttttcctga gtttcctctg agggccccct cttctctcta ggacaattaa      1020
     gggatgacgt ctctgaggaa atggagggga agacagtccc tagaatactg atcaggggtc      1080
     ccctttgacc cctgcagcag ccttgggaac cgtgactttt cctctcaggc cttgttctct      1140
     gcctcacact cagtgtgttt ggggctctga ttccagcact tctgagtcac tttacctcca      1200
     ctcagatcag gagcagaagt ccctgttccc cgctcagaga ctcgaacttt ccaatgaata      1260
     ggagattatc ccaggtgcct gcgtccaggc tggtgtctgg gttctgtgcc ccttccccac      1320
     accaggtgtc ctgtccattc tcaggctggt cacatgggtg gtcctagggt gtcccatgag      1380
     agatgcaaag cgcctgaatt ttctgactct tcccatcaga ccccccaaag acacacgtga      1440
     cccaccaccc cgtctctgac catgaggcca ccctgaggtg ctgggccctg ggcttctacc      1500
     ctgcggagat cacactgacc tggcagcggg atggcgagga ccaaactcag gacactgagc      1560
     ttgtggagac cagaccagca ggagatagaa ccttccagaa gtgggcagct gtggtggtgc      1620
     cttctggaga agagcagaga tacacatgcc atgtacagca tgaggggctg ccgaagcccc      1680
     tcaccctgag atggggtaag gagggggatg aggggtcata tctcttctca gggaaagcag      1740
     gagcccttct ggagcccttc agcagggtca gggcccctcg tcttcccctc ctttcccaga      1800
     gccatcttcc cagtccacca tccccatcgt gggcattgtt gctggcctgg ctgtcct         1857
//