spacer

EBI Dbfetch

ID   AY428811; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY428811;
XX
DT   29-DEC-2003 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Edelshtein D., Sidebottom D., Baluyut K.L., Baxter-Lowe L.A.;
RT   "A Novel DRB1 Allele Identified by Sequence-Based Typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Edelshtein D., Sidebottom D., Baluyut K.L., Baxter-Lowe L.A.;
RT   ;
RL   Submitted (07-OCT-2003) to the INSDC.
RL   Surgery, UCSF, 45 Castro St. Main Hospital Level B, San Francisco, CA
RL   94114, USA
XX
DR   MD5; 70349123d13bb825da61ba43dca1aafc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6T862"
FT                   /db_xref="IMGT/HLA:DRB1*08:27"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6T862"
FT                   /protein_id="AAR29079.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNREEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccgag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer