spacer

EBI Dbfetch

ID   AH013346; SV 3; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   AH013346; AY428803-AY428804;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   06-DEC-2011 (Rel. 111, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2417 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Steiner N.K., Burdett L., Hurley C.K., Fernandez-Vina M.;
RT   "Novel HLA-A Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Steiner N.K., Burdett L., Hurley C.K., Fernandez-Vina M.;
RT   ;
RL   Submitted (07-OCT-2003) to the INSDC.
RL   Microbiology & Immunology, Georgetown University Medical Center, 3970
RL   Reservoir Rd. N.W., Washington, D.C. 20057, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-787
RA   Lazaro A., Steiner N.K., Burdett L., Hurley C.K., Fernandez-Vina M.;
RT   ;
RL   Submitted (05-DEC-2011) to the INSDC.
RL   Microbiology & Immunology, Georgetown University Medical Center, 3970
RL   Reservoir Rd. N.W., Washington, D.C. 20057, USA
XX
CC   On Dec 5, 2011 this sequence version replaced gi:342160043.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2417 variant"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2417 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2417 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6T866"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6T866"
FT                   /protein_id="AAR07615.2"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2417 variant"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2417 variant"
FT                   /number=3
XX
SQ   Sequence 787 BP; 112 A; 166 C; 195 G; 73 T; 241 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatatg aaggcccact cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagatcacca agcgcaagtg ggaggcggcc catgcggcgg agcagcagag agcctacctg       720
     gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer