Dbfetch

ID   AY396024; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY396024;
XX
DT   24-OCT-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1305v allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Gedil M.A., Steiner N.K., Hurley C.K.;
RT   "Novel DRB1 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Gedil M.A., Steiner N.K., Hurley C.K.;
RT   ;
RL   Submitted (22-SEP-2003) to the INSDC.
RL   Lombardi Cancer Center, Georgetown University, 3970 Reservoir Road, NW,
RL   Washington, DC 20057, USA
XX
DR   MD5; c5f11e2d18238dcefb5197c1050c5b51.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /isolate="NT00500"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1305v"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6TKG7"
FT                   /db_xref="IMGT/HLA:DRB1*13:56"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6TKG7"
FT                   /protein_id="AAQ96776.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 66 C; 97 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//