spacer

EBI Dbfetch

ID   AY394720; SV 1; linear; genomic DNA; STD; HUM; 189 BP.
XX
AC   AY394720;
XX
DT   24-OCT-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB4) gene, HLA-DRB4*010101 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-189
RA   Mele L., Binello S., Balza G., Mazzola G., Garino E.;
RT   "DRB4* genomic sequence: a new allele";
RL   Unpublished.
XX
RN   [2]
RP   1-189
RA   Mele L., Binello S., Balza G., Mazzola G., Garino E.;
RT   ;
RL   Submitted (18-SEP-2003) to the INSDC.
RL   Haematology and Transfusion Medicine, Hospital, via Venezia 16, Alessandria
RL   15100, Italy
XX
DR   MD5; f21c1e162fd8aac2754a0bc211f693c5.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000411959; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..189
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3-p21.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>189
FT                   /gene="HLA-DRB4"
FT                   /allele="010101 variant"
FT   mRNA            <1..>189
FT                   /gene="HLA-DRB4"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>189
FT                   /codon_start=1
FT                   /gene="HLA-DRB4"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P13762"
FT                   /db_xref="HGNC:HGNC:4952"
FT                   /db_xref="IMGT/HLA:DRB4*01:07"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13762"
FT                   /protein_id="AAQ96922.1"
FT                   /translation="RYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRA
FT                   EVDTYCRYNYRVVESFTV"
FT   exon            <1..189
FT                   /gene="HLA-DRB4"
FT                   /number=2
XX
SQ   Sequence 189 BP; 48 A; 46 C; 67 G; 28 T; 0 other;
     agatacatct ataaccaaga ggagtacgcg cgctacaaca gtgacctggg ggagtaccag        60
     gcggtgacgg agctggggcg gcctgacgct gagtactgga acagccagaa ggacctcctg       120
     gagcggaggc gggccgaggt ggacacctac tgcagataca actaccgggt tgtggagagc       180
     ttcacagtg                                                               189
//


spacer
spacer