spacer

EBI Dbfetch

ID   AY375940; SV 1; linear; genomic DNA; STD; HUM; 2335 BP.
XX
AC   AY375940;
XX
DT   01-SEP-2004 (Rel. 81, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens 4AOH 100100 BRO LJ MHC class II antigen (HLA-DQA1) gene,
DE   HLA-DQA1*05011 allele, exons 2 through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2335
RA   Ashdown M.L., Leas L., Gavrilidis A., Wood J.M., Simons M.J.;
RT   "HLA-DQA1 Intron 1 to Exon 5";
RL   Unpublished.
XX
RN   [2]
RP   1-2335
RA   Ashdown M.L., Leas L., Gavrilidis A., Wood J.M., Simons M.J.;
RT   ;
RL   Submitted (26-AUG-2003) to the INSDC.
RL   GeneType Pty Ltd, 60-66 Hanover Street, Fitzroy, Victoria 3065, Australia
XX
DR   MD5; e2f47063041c12d6b76daccadfac6963.
DR   Ensembl-Gn; ENSG00000206305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000257473; homo_sapiens.
DR   Ensembl-Tr; ENST00000383251; homo_sapiens.
DR   Ensembl-Tr; ENST00000399675; homo_sapiens.
DR   Ensembl-Tr; ENST00000399678; homo_sapiens.
DR   Ensembl-Tr; ENST00000552745; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2335
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DQA1*05011 DRB1*0301 DRB3*01011"
FT                   /cell_line="4AOH 100100 BRO LJ"
FT                   /db_xref="taxon:9606"
FT   gene            <1..2335
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05011"
FT   mRNA            join(<450..695,1108..1389,1753..1927,2092..2329)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05011"
FT                   /product="MHC class II antigen"
FT   CDS             join(<450..695,1108..1389,1753..1907)
FT                   /codon_start=3
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05011"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q67AD8"
FT                   /db_xref="IMGT/HLA:DQA1*05:01:01:02"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q67AD8"
FT                   /protein_id="AAQ91420.1"
FT                   /translation="DHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPV
FT                   LRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILIC
FT                   LVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVE
FT                   HWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRH
FT                   QGPL"
FT   exon            450..695
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05011"
FT                   /number=2
FT   exon            1108..1389
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05011"
FT                   /number=3
FT   exon            1753..1927
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05011"
FT                   /number=4
FT   exon            2092..2335
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*05011"
FT                   /number=5
XX
SQ   Sequence 2335 BP; 609 A; 565 C; 490 G; 671 T; 0 other;
     ccagtcctga gaggaaagaa aatacaatca gtttgttatt aactgatgaa agaattaagt        60
     gaaagatgaa tcttaggaag cagaaggaag taaacctaat ctctgactaa gaaagctaaa       120
     taccataata actcattcat tccttctttt gttcaattac attatttaat cataagtccg       180
     tgatgtgcca ggcactcagg aaatagtaaa aactggacat gtgatattct gcccttgtgt       240
     agcgcacatt atagtgggaa agaaagcgca attttaaccg gacaactacc aacaataaga       300
     gtggaggaag caggggttgg aaatgtccac aggctgtgcc aaagatgaag cccgtaatat       360
     ttgaaagtca gtttctttca tcattttgtg tattaaggtt ctttcttccc ctgttctcca       420
     ccttcctgct tgtcatcttc actcatcagc tgaccacgtc gcctcttatg gtgtaaactt       480
     gtaccagtct tacggtccct ctggccagta cacccatgaa tttgatggag atgagcagtt       540
     ctacgtggac ctggggagga aggagactgt ctggtgtttg cctgttctca gacaatttag       600
     atttgacccg caatttgcac tgacaaacat cgctgtccta aaacataact tgaacagtct       660
     gattaaacgc tccaactcta ccgctgctac caatggtatg tgtcaacaat tctgcccctc       720
     tttactgatt tatcccttca taccaagttt cattatttta tttccaagag gtccccagat       780
     cttctcatgg caattgctga aattttatca tctcccatct ctaaaatcac atattcccat       840
     gtaatacaag ggtctttcca ttatccattc attaaatcct tctcggagag gtctcatcaa       900
     cctcctactt tattaaacat gcccacagag agaagggcac aggaataaag cgaaggcaat       960
     gtgtcgttgc tcccaagcag aaggtaaata agacctcttt gactatcagg tggtgaaatg      1020
     ctggtaggag ggctcttcca ggatgtaatg cagaagctca tggcagagct attcacactt      1080
     cacatcagtg ctgtttcctc accacagagg ttcctgaggt cacagtgttt tccaagtctc      1140
     ccgtgacact gggtcagccc aacatcctca tctgtcttgt ggacaacatc tttcctcctg      1200
     tggtcaacat cacatggctg agcaatgggc actcagtcac agaaggtgtt tctgagacca      1260
     gcttcctctc caagagtgat cattccttct tcaagatcag ttacctcacc ctcctccctt      1320
     ctgctgagga gagttatgac tgcaaggtgg agcactgggg cctggacaag cctcttctga      1380
     aacactgggg taaggatgag ttccaccact ttttgatgct ttcttgtctg tcaagttcag      1440
     aacttcctgc cttttactcc tatatcccaa aacttgtttt ccacacttca tgggtttctt      1500
     tctttctttt gaaagaataa agcaacaaaa gcaaagattt attgaaaatg aaagtacact      1560
     tcacagggtg ggaacgggcc tgagcatagg ggctcaagag ccacttcatg gttttctaat      1620
     gatagacttc actctcctcc ctaagctggg gaccttgagt ctttgcagag ccaaccctcc      1680
     accccatccc atcccacaca catgcacatg agcacactct gctttctgac ctcaacgact      1740
     tcatatccac agagcctgag attccagccc ctatgtcaga gctcacagag actgtggtct      1800
     gcgccctggg attgtctgtg ggcctcgtgg gcattgtggt gggcactgtc ttcatcatcc      1860
     gaggcctgcg ttcagttggt gcttccagac accaagggcc cttgtgaatc ccatcctgga      1920
     atggaaggta agattgagat ttgttagagc tgaatccgca gtatgagagg aaggaaagtg      1980
     gaggaggctg tggacatgaa tggttgaaag ttgtagggga attgggaagt ggcatgatga      2040
     tgacatagga gcggcctagg acccatccat ctcatgtctg tcctgttgca ggtgcatcgc      2100
     catctacagg agcagaagag tggacttgct acatgaccta gcattatttt ctggccccat      2160
     ttatcatatc ccttttctcc tccaaatgtt tctcctctca cctcttctgt gggacttaaa      2220
     ttgctatatc tgctcagagc tcacaaatgc ctttgaatta tttccctgac ttcctgattt      2280
     ttttcttctt aagtgttacc tactaagagt tgcctggagt aagccaccca gctac           2335
//


spacer
spacer