spacer

EBI Dbfetch

ID   AY374100; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AY374100;
XX
DT   01-OCT-2004 (Rel. 81, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens clone APC5189 MHC class II antigen (HLA-DPB1) gene, HLA-DPB1
DE   variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RX   DOI; 10.1111/j.1399-0039.2004.00276.x.
RX   PUBMED; 15361132.
RA   Lv F., Lin J., Liu Z., Gao J., Fu Y., Xu A.;
RT   "Identification of a novel HLA-DPB1 allele--DPB1*0102";
RL   Tissue Antigens 64(4):512-514(2004).
XX
RN   [2]
RP   1-264
RA   Lv F., Lin J., Liu Z., Fu Y., Xu A.;
RT   "A novel HLA-DPB1 allele found in Hans population of South China";
RL   Unpublished.
XX
RN   [3]
RP   1-264
RA   Lv F., Lin J., Liu Z., Fu Y., Xu A.;
RT   ;
RL   Submitted (27-AUG-2003) to the INSDC.
RL   Department of Biochemistry, Sun Yat-Sen University, 135 W. Xingang Rd.,
RL   Guangzhou, GD 510275, P.R. China
XX
DR   MD5; 40a4da9ae1080878d1a25bc53ed96900.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="APC5189"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1 variant"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*100:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAR21105.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTE
FT                   LGRPEAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRR"
FT   exon            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1 variant"
FT                   /number=2
XX
SQ   Sequence 264 BP; 61 A; 66 C; 98 G; 39 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagc tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg aggcggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer