spacer

EBI Dbfetch

ID   AY374099; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY374099;
XX
DT   12-MAY-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens clone HSR289 MHC class II antigen (HLA-DRB1) gene, HLA-DRB1
DE   variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.0001-2815.2004.00215.x.
RX   PUBMED; 15140046.
RA   Lv F., Gao J., Lin J., Liu Z., Fu Y., Lin B., Liu Y., Xu A.;
RT   "A novel HLA-DRB1 allele, DRB1*0449, with a rare point mutation found in
RT   the Han population of Guangdong China";
RL   Tissue Antigens 63(6):612-613(2004).
XX
RN   [2]
RP   1-270
RA   Lv F., Lin J., Liu Z., Fu Y., Liu Y., Lin B., Liu X., Fan X., Zhang Z.,
RA   Xu A.;
RT   ;
RL   Submitted (26-AUG-2003) to the INSDC.
RL   Department of Biochemistry, Sun Yat-Sen University, 135 W. Xingang Rd.,
RL   Guangzhou, GD 510275, P.R. China
XX
DR   MD5; edd9bb85cf08dc02cb4a00aac9c51e12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="HSR289"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6UB42"
FT                   /db_xref="IMGT/HLA:DRB1*04:49"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6UB42"
FT                   /protein_id="AAR21104.1"
FT                   /translation="RFLEQIKHECHFFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 65 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcagatt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer