spacer

EBI Dbfetch

ID   AH013197; SV 3; linear; genomic DNA; STD; HUM; 1024 BP.
XX
AC   AH013197; AY362881-AY362883;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-A) gene, HLA-A*01null
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1024
RX   DOI; 10.1111/j.1399-0039.2005.00528.x.
RX   PUBMED; 16451203.
RA   Bera O., Dubois V., Assaqa A., Belon P., Favre-Victoire I., Gebuhrer L.;
RT   "A deletion in exon 3 results in a new HLA-A*01 null allele (A*0115N) in a
RT   Martinican woman";
RL   Tissue Antigens 67(1):61-63(2006).
XX
RN   [2]
RP   1-1024
RA   Dubois V., Bera O., Labonne M.P., Gebuhrer L.;
RT   "A new HLA-A*01 null allele";
RL   Unpublished.
XX
RN   [3]
RP   1-1024
RA   Bera O., Dubois V., Gebuhrer L.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   HLA Laboratory, EFS Rhone Alpes, 1-3 rue du Vercors, Lyon 69007, France
XX
RN   [4]
RC   Sequence update by submitter
RP   1-273
RA   Bera O., Dubois V., Gebuhrer L.;
RT   ;
RL   Submitted (04-NOV-2004) to the INSDC.
RL   HLA Laboratory, EFS Rhone Alpes, 1-3 rue du Vercors, Lyon 69007, France
XX
DR   MD5; 55a461774cbcf941e179fb365f5763c7.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:55380581, gi:34420918, gi:34420919, gi:55380580.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1024
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1024
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01null"
FT   mRNA            join(<1..273,374..649,750..>1024)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01null"
FT                   /product="truncated MHC class I antigen"
FT   CDS             join(<1..273,374..649,750..769)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01null"
FT                   /product="truncated MHC class I antigen"
FT                   /protein_id="AAQ67705.2"
FT                   /translation="GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKM
FT                   EPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVG
FT                   PDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGG
FT                   AWTGSADTWRTGRRRCSARTPPRHI"
FT   exon            1..273
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01null"
FT                   /number=2
FT   gap             274..373
FT                   /estimated_length=unknown
FT   exon            374..649
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01null"
FT                   /number=3
FT                   /note="deletion within this exon leads to altered reading
FT                   frame and premature termination of this protein in exon 4"
FT   gap             650..749
FT                   /estimated_length=unknown
FT   exon            750..1024
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01null"
FT                   /number=4
XX
SQ   Sequence 1024 BP; 171 A; 251 C; 285 G; 117 T; 200 other;
     cgggctccca ctccatgagg tatttcttca catccgtgtc ccggcccggc cgcggggagc        60
     cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg       120
     ccgcgagcca gaagatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt       180
     gggaccagga gacacggaat atgaaggccc actcacagac tgaccgagcg aacctgggga       240
     ccctgcgcgg ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnngttctca caccatccag ataatgtatg gctgcgacgt ggggccggac       420
     gggcgcttcc tccgcgggta ccggcaggac gcctacgacg gcaaggatta catcgccctg       480
     aacgaggacc tgcgctcttg gaccgcggcg gacatggcag ctcagatcac caagcgcaag       540
     tgggaggcgg tccatgcggc ggagcagcgg agagtctacc tggagggcgg tgcgtggacg       600
     ggctccgcag atacctggag aacgggaagg agacgctgca gcgcacggan nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc ccccccaaga cacatatgac ccaccacccc       780
     atctctgacc atgaggccac cctgaggtgc tgggccctgg gcttctaccc tgcggagatc       840
     acactgacct ggcagcggga tggggaggac cagacccagg acacggagct cgtggagacc       900
     aggcctgcag gggatggaac cttccagaag tgggcggctg tggtggtgcc ttctggagag       960
     gagcagagat acacctgcca tgtgcagcat gagggtctgc ccaagcccct caccctgaga      1020
     tggg                                                                   1024
//


spacer
spacer