Dbfetch

ID   AY339847; SV 1; linear; genomic DNA; STD; HUM; 1267 BP.
XX
AC   AY339847;
XX
DT   05-AUG-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5502 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1267
RX   DOI; 10.1111/j.1399-0039.2006.00669.x.
RX   PUBMED; 17026471.
RA   Chen Q., Zou H., Xu X.H., Luo M., Wang J., Zuo Y.Q., Chen Y.H., Chen X.H.,
RA   Chen X.L., Yao Z.Q., Song N., Zeng J., Mi X.Y., Sun S.X., Wang J.X.,
RA   Zhao T.M.;
RT   "Characterization of HLA-B*5516, -B*1313, -B*9512, and -DRB1*1457 alleles
RT   identified in a southwest Chinese population";
RL   Tissue Antigens 68(4):339-343(2006).
XX
RN   [2]
RP   1-1267
RA   Chen Q., Wang J., Sun S., Zou H., Xu X., Chen X., Mi X., Chen X., Zeng J.,
RA   Zhao T.;
RT   "Identification of a novel allele HLA-B*55XX in a Chinese potential bone
RT   marrow donor";
RL   Unpublished.
XX
RN   [3]
RP   1-1267
RA   Chen Q., Wang J., Sun S., Zou H., Xu X., Chen X., Mi X., Chen X., Zeng J.,
RA   Zhao T.;
RT   ;
RL   Submitted (10-JUL-2003) to the INSDC.
RL   MCIGS, NIAID, National Institutes of Health, 50 South Drive, Bldg #50 Rm
RL   5516, Bethesda, MD 20892, USA
XX
DR   MD5; 9eadbec7bb9f283dcfe2007ac0c8a8fa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="CHD635"
FT                   /db_xref="taxon:9606"
FT   gene            1..>1267
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT   mRNA            join(1..92,221..490,736..>1011)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /product="MHC class I antigen"
FT   exon            1..92
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /number=1
FT   5'UTR           1..19
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT   CDS             join(20..92,221..490,736..>1011)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; leucocyte antigen;
FT                   antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*55:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP55"
FT                   /protein_id="AAQ16164.1"
FT                   /translation="MRVTAPRTLLLLLWGALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRN
FT                   LRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            221..490
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /number=2
FT   exon            736..1011
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5502 variant"
FT                   /number=3
XX
SQ   Sequence 1267 BP; 230 A; 398 C; 454 G; 185 T; 0 other;
     agtctcctca gacaccgaga tgcgggtcac ggcaccccga accctcctcc tgctgctctg        60
     gggggccctg gccctgaccg agacctgggc cggtgagtgc gggtcgggag ggaaatggcc       120
     tctgtgggga ggagcgaggg gaccgcaggc gggggcgcag gacccgggga gccgcgccgg       180
     gaggagggtc tggcgggtct cagcccctcc tcgcccccag gctcccactc catgaggtat       240
     ttccacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcgc agtgggctac       300
     gtggacgaca cgcagttcgt gaggttcgac agcgacgccg cgagtccgag agaggagccg       360
     cgggcgccgt ggatagagca ggaggggccg gagtattggg accggaacac acagatctac       420
     aaggcccagg cacagactga ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag       480
     agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt       540
     acggcccggg tcgccccgag tctccgggtc cgagatccgc ctccctgagg ccgcgggacc       600
     cgcccagacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca ttttcagttg       660
     aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcgggggacg gggctgaccg       720
     cggggccggg gccagggtct cacacttggc agacgatgta tggctgcgac ctggggccgg       780
     acgggcgcct cctccgcggg cataaccagt tagcctacga cggcaaggat tacatcgccc       840
     tgaacgagga cctgagctcc tggaccgcgg cggacaccgc ggctcagatc acccagcgca       900
     agtgggaggc ggcccgtgtg gcggagcagc tgagagccta cctggagggc acgtgcgtgg       960
     agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg ggtaccaggg      1020
     gcagtgggga gccttcccca tctcctatag gtcgccgggg atggcctccc acgagaagag      1080
     gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg aatggagaat ggcatgagtt      1140
     ttcctgagtt tcctctgagg gccccctctt ctctctagga caattaaggg atgacgtctc      1200
     tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcctc tttgacccct      1260
     gcagcag                                                                1267
//