spacer

EBI Dbfetch

ID   AH013029; SV 2; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   AH013029; AY333121-AY333122;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II HLA-DQ-beta chain (HLA-DQB1) gene, HLA-DQB1*02
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Gragg H., Cordovado S.K., Hendrix M.M., Mueller P.W.;
RT   "Identification of a Novel HLA-DQB1*02 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-652
RA   Gragg H., Cordovado S.K., Hendrix M.M., Mueller P.W.;
RT   ;
RL   Submitted (30-JUN-2003) to the INSDC.
RL   NCEH/DLS/MBB/DMRAS, Centers for Disease Control and Prevention, 4770 Buford
RL   Highway MS F-50, Atlanta, GA 30341, USA
XX
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
DR   IMGT/LIGM; AH013029.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:33088046, gi:33088047, gi:33088045.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02"
FT   mRNA            join(<1..270,371..>652)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02"
FT                   /product="MHC class II HLA-DQ-beta chain"
FT                   /note="binds to the T cell receptor"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAP93137.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAV
FT                   TLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDEEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02"
FT                   /number=2
FT                   /note="similar to HLA-DBQ1*0201 allele"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..652
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*02"
FT                   /number=3
FT   variation       493
FT                   /gene="HLA-DQB1"
FT                   /replace="c"
FT                   /note="results in glu to gln change; differentiates it from
FT                   HLA-DBQ1*0201"
XX
SQ   Sequence 652 BP; 123 A; 158 C; 171 G; 100 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggaca gagcgcgtgc        60
     gtcttgtgag cagaagcatc tataaccgag aagagatcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg ctgctggggc tgcctgccgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggaaa cgggcggcgg tggacagggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tggagcccac agtgaccatc tccccatcca ggacagaggc cctcaaccac       420
     cacaacctgc tggtctgctc ggtgacagat ttctatccag cccagatcaa agtccggtgg       480
     tttcggaatg acgaggagga gacagctggc gttgtgtcca ccccccttat taggaatggt       540
     gactggacct tccagatcct ggtgatgctg gaaatgactc cccagcgtgg agacgtctac       600
     acctgccacg tggagcaccc cagcctccag agccccatca ccgtggagtg gc               652
//


spacer
spacer