Dbfetch

ID   AY330170; SV 1; linear; genomic DNA; STD; HUM; 1895 BP.
XX
AC   AY330170;
XX
DT   28-AUG-2003 (Rel. 77, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA) gene, HLA*020101 variant allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1895
RA   Hiraki D.D., Perez C.C., Grumet C.;
RT   ;
RL   Submitted (25-JUN-2003) to the INSDC.
RL   Pathology, Stanford University, 800 Welch Rd, Palo Alto, CA 94304, USA
XX
DR   MD5; c6179f44e657fc0e887e5f1b6c873507.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1895
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1895
FT                   /gene="HLA"
FT                   /allele="HLA*020101 variant"
FT                   /note="HLA*A2"
FT   mRNA            join(<1..48,179..448,690..965,1566..>1841)
FT                   /gene="HLA"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..48,179..448,690..965,1566..>1841)
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*02:66"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6VS85"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAQ24372.1"
FT                   /translation="VLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDD
FT                   TQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSE
FT                   AGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWE
FT                   AAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALS
FT                   FYPAEITLTWQRDGEDQIQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGL
FT                   PKPLTLRW"
FT   exon            <1..48
FT                   /gene="HLA"
FT                   /number=1
FT   exon            179..448
FT                   /gene="HLA"
FT                   /number=2
FT   exon            690..965
FT                   /gene="HLA"
FT                   /number=3
FT   exon            1566..1841
FT                   /gene="HLA"
FT                   /number=4
XX
SQ   Sequence 1895 BP; 364 A; 568 C; 622 G; 341 T; 0 other;
     tcgtcctgct actctcgggg gctctggccc tgacccagac ctgggcgggt gagtgcgggg        60
     tcgggaggga aacggcctct gtggggagaa gcaacgggcc cgcctggcgg gggcgcagga       120
     cccgggaagc cgcgccggga ggagggtcgg gcgggtctca gccactcctc gtccccaggc       180
     tctcactcca tgaggtattt cttcacatcc gtgtcccggc ccggccgcgg ggagccccgc       240
     ttcatcgcag tgggctacgt ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg       300
     agccagagga tggagccgcg ggcgccgtgg atagagcagg agggtccgga gtattgggac       360
     ggggagacac ggaaagtgaa ggcccactca cagactcacc gagtggacct ggggaccctg       420
     cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc gcaggtcacg       480
     acctctcatc ccccacggac gggccaggtc gcccacagtc tccgggtccg agatccgccc       540
     cgaagccgcg ggaccccgag acccttgccc cgggagaggc ccaggcgcct ttacccggtt       600
     tcattttcag tttaggccaa aaatcccccc aggttggtcg gggcggggcg gggctcgggg       660
     gaccgggctg accgcggggt ccgggccagg ttctcacacc gtccagagga tgtatggctg       720
     cgacgtgggg tcggactggc gcttcctccg cgggtaccac cagtacgcct acgacggcaa       780
     ggattacatc gccctgaaag aggacctgcg ctcttggacc gcggcggaca tggcagctca       840
     gaccaccaag cacaagtggg aggcggccca tgtggcggag cagttgagag cctacctgga       900
     gggcacgtgc gtggagtggc tccgcagata cctggagaac gggaaggaga cgctgcagcg       960
     cacgggtacc aggggccacg gggcgcctcc ctgatcgcct gtagatctcc cgggctggcc      1020
     tcccacaagg aggggagaca attgggacca acactagaat atcaccctcc ctctggtcct      1080
     gagggagagg aatcctcctg ggtttccaga tcctgtacca gagagtgact ctgaggttcc      1140
     gccctgctct ctgacacaat taagggataa aatctctgac ggaatgacgg gaagacgatc      1200
     cctcgaatac tgatgagtgg ttccctttga cacacacagg cagcagcctt gggcccgtga      1260
     cttttcctct caggccttgt tctctgcttc acactcaatg tgtgtggggg tctgagtcca      1320
     gcacttctga gtccttcagc ctccactcag gtcaggacca gaagtcgctg ttccctcttc      1380
     agggactaga attttccacg gaataggaga ttatcccagg tgcctgtgtc caggctggtg      1440
     tctgggttct gtgctccctt ccccatccca ggtgtcctgt ccattctcaa gatagccaca      1500
     tgtgtgctgg aggagtgtcc catgacagat gcaaaatgcc tgaatgatct gactcttcct      1560
     gacagacgcc cccaaaacgc atatgactca ccacgctgtc tctgaccatg aagccaccct      1620
     gaggtgctgg gccctgagct tctaccctgc ggagatcaca ctgacctggc agcgggatgg      1680
     ggaggaccag atccaggaca cggagctcgt ggagaccagg cctgcagggg atggaacctt      1740
     ccagaagtgg gcggctgtgg tggtgccttc tggacaggag cagagataca cctgccatgt      1800
     gcagcatgag ggtttgccca agcccctcac cctgagatgg ggtaaggagg gagacggggg      1860
     tgtcatgtct tttagggaaa gcaggagcct ctctg                                 1895
//