spacer

EBI Dbfetch

ID   AY326105; SV 1; linear; genomic DNA; STD; ROD; 1233 BP.
XX
AC   AY326105;
XX
DT   01-JAN-2004 (Rel. 78, Created)
DT   11-MAR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Rattus exulans interphotoreceptor retinoid-binding protein (IRBP) gene,
DE   partial cds.
XX
KW   .
XX
OS   Rattus exulans (Polynesian rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-1233
RX   DOI; 10.1016/j.ympev.2003.07.002.
RX   PUBMED; 15019624.
RA   Jansa S.A., Weksler M.;
RT   "Phylogeny of muroid rodents: relationships within and among major lineages
RT   as determined by IRBP gene sequences";
RL   Mol. Phylogenet. Evol. 31(1):256-276(2004).
XX
RN   [2]
RP   1-1233
RA   Jansa S.A., Weksler M.;
RT   ;
RL   Submitted (19-JUN-2003) to the INSDC.
RL   Bell Museum of Natural History and Department of Ecology, Evolution, and
RL   Behavior, University of Minnesota, 1987 Upper Buford Circle, St. Paul, MN
RL   55103, USA
XX
DR   MD5; 7cad2f4edef9b871f979cb55d225ee98.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1233
FT                   /organism="Rattus exulans"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="USNM458836"
FT                   /db_xref="taxon:34854"
FT   gene            <1..>1233
FT                   /gene="IRBP"
FT   mRNA            <1..>1233
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT   CDS             <1..>1233
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="GOA:Q6VUL7"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6VUL7"
FT                   /protein_id="AAQ94667.1"
FT                   /translation="LMEMQXAIEQAMKSHEILGISDPQTLAHVLTVGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALTDLTREELLAQIQRNIRHEVLEDNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWKQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSDFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLVSMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETPSRPETGPNEPPAVTPEVPKEEAARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTLG"
XX
SQ   Sequence 1233 BP; 262 A; 357 C; 364 G; 249 T; 1 other;
     ctgatggaaa tgcaantagc cattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcggaccctc agacgctggc ccatgtgctg acagttggag tccaaagctc tttgaatgac       120
     ccacgtctct tcatctccta tgagcccagt acccttgagg ccccccagca agcaccagca       180
     ctcaccgacc tcacccgaga agagctgctg gcccagatac agaggaacat ccgccatgag       240
     gttcttgagg ataacgtggg ctacctacga gtggatgatc tccctggaca ggaggtactg       300
     agtgagcttg gggagttcct agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttggtgctag atctccgtca ctgtgctggt ggccatgtct ctgggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cacagtcatg cacgtggata ccatctacga tcggccctcc       480
     aacaccacca cagagatctg gaccttgcct aaggtcctgg gggagagata cagtgctgac       540
     aaggatgtgg tggtcctcac cagtggacac actgggggag tagccgagga catcgcttac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggacggaggg tggtgccctg       660
     gacctccaga agctgagaat aggccagtcc gactttttcc ttacagtacc tgtgtccagg       720
     tccctggggc ccctaggtgg aggcggccaa acatgggaag gcagcggagt gctgccctgt       780
     gtggggatac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gcgttgtcct ccgactccag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccacctg gtcagcatgg actactcggc cgtggtctcc       960
     gaagaggacc tggtgacaaa gctcaatgct ggtttgcagg ctgtgtcgga ggatcccagg      1020
     ctcctggtga gagccactgg acccagagaa accccctcaa gacctgagac tggccctaac      1080
     gagccaccag cagtcacccc tgaggtgccc aaggaagaag ctgcccggag ggccctagtg      1140
     gactccgtgt ttcaggtgtc cgtgctgccg ggcaatgtgg gctacctgcg ctttgacaga      1200
     tttgcagatg cctctgtgct gaagacactg ggc                                   1233
//


spacer
spacer