spacer

EBI Dbfetch

ID   AY326103; SV 1; linear; genomic DNA; STD; ROD; 1233 BP.
XX
AC   AY326103;
XX
DT   01-JAN-2004 (Rel. 78, Created)
DT   11-MAR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Phloeomys cumingi interphotoreceptor retinoid-binding protein (IRBP) gene,
DE   partial cds.
XX
KW   .
XX
OS   Phloeomys cumingi (Southern Luzon giant cloud rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Phloeomys.
XX
RN   [1]
RP   1-1233
RX   DOI; 10.1016/j.ympev.2003.07.002.
RX   PUBMED; 15019624.
RA   Jansa S.A., Weksler M.;
RT   "Phylogeny of muroid rodents: relationships within and among major lineages
RT   as determined by IRBP gene sequences";
RL   Mol. Phylogenet. Evol. 31(1):256-276(2004).
XX
RN   [2]
RP   1-1233
RA   Jansa S.A., Weksler M.;
RT   ;
RL   Submitted (19-JUN-2003) to the INSDC.
RL   Bell Museum of Natural History and Department of Ecology, Evolution, and
RL   Behavior, University of Minnesota, 1987 Upper Buford Circle, St. Paul, MN
RL   55103, USA
XX
DR   MD5; 6412c11b009a8e3998c4366c3b6ce116.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1233
FT                   /organism="Phloeomys cumingi"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="USNM573332"
FT                   /db_xref="taxon:248813"
FT   gene            <1..>1233
FT                   /gene="IRBP"
FT   mRNA            <1..>1233
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT   CDS             <1..>1233
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="GOA:Q6VUL9"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6VUL9"
FT                   /protein_id="AAQ94665.1"
FT                   /translation="LMGMQAAIEQAMKSHEILDISDPQTLAHVLTAGVQSSLNDXRLFI
FT                   SYEPNTLEAPQQAPALANLTREELLAQIQRNIHHEVLESNVGYLRVDDLPSQEVLSELG
FT                   EFLVTHVWQQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVVHVDTIYDRPSNTT
FT                   TEIWTLPKVLGDRYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVFRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETSPRPETGPNEPPEATPEVPKEEAARRALVNSVFQVSVLPGNVGYLRFD
FT                   RFADASVLRALG"
XX
SQ   Sequence 1233 BP; 263 A; 354 C; 362 G; 253 T; 1 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctggacatc        60
     tcagaccctc agacgctggc ccatgtgctg acagctggag tgcagagttc cttgaatgac       120
     cygcgtctct tcatctccta tgagcccaat accctcgagg ctccccagca agctccagca       180
     ctcgccaacc tcacccgaga agagctgctg gcccagatac agaggaacat ccaccatgag       240
     gttcttgaga gcaacgtggg ctacctacga gtggatgacc tcccaagcca ggaggtactg       300
     agtgagctgg gggagttctt ggtgacccat gtgtggcagc agctcatggg cacctcctcc       360
     ttggtgctag atctccggca ctgcgctggt ggccatgtct ctgggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cactgtcgtg cacgtggata ccatctatga ccgtccctcc       480
     aataccacca cagagatctg gaccttgccc aaggtcctag gggacagata cagtgctgac       540
     aaagatgtgg tggtcctcac cagtggacat actgggggag tggctgagga catcgcctac       600
     atcctcaagc agatgcgcag ggccattgtg gtgggtgagc ggacggaggg tggtgccctg       660
     gatctccaga agctgagaat aggccagtcc aacttcttcc tcacagtgcc tgtgtccagg       720
     tccctgggac ccctgggtgg aggtggccag acatgggaag gcagtggagt gctaccctgt       780
     gtggggacac ctgcagagca agctctagaa aaggccctgg ccatcctcac cctgcgccgt       840
     gccctgccag gggttgtctt ccgacttcag gaagcccttc aggactatta cacattagtg       900
     gaccgagtgc caggcctgct acaccacctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg ctgtgtcgga ggatcccagg      1020
     ctcctagtaa gagccactgg acccagagaa acctccccaa gacctgagac tgggcctaat      1080
     gagcccccag aagccacccc tgaggtgccc aaggaagaag ctgcccggag ggccctagtg      1140
     aactctgtgt ttcaggtgtc tgtgctgccg ggcaatgtgg gctacctgcg ctttgacaga      1200
     tttgcagatg cttctgtgct gagggcactg ggc                                   1233
//


spacer
spacer