spacer

EBI Dbfetch

ID   AY326094; SV 1; linear; genomic DNA; STD; ROD; 1176 BP.
XX
AC   AY326094;
XX
DT   01-JAN-2004 (Rel. 78, Created)
DT   11-MAR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Maxomys whiteheadi interphotoreceptor retinoid-binding protein (IRBP) gene,
DE   partial cds.
XX
KW   .
XX
OS   Maxomys whiteheadi (Whitehead's spiny rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Maxomys.
XX
RN   [1]
RP   1-1176
RX   DOI; 10.1016/j.ympev.2003.07.002.
RX   PUBMED; 15019624.
RA   Jansa S.A., Weksler M.;
RT   "Phylogeny of muroid rodents: relationships within and among major lineages
RT   as determined by IRBP gene sequences";
RL   Mol. Phylogenet. Evol. 31(1):256-276(2004).
XX
RN   [2]
RP   1-1176
RA   Jansa S.A., Weksler M.;
RT   ;
RL   Submitted (19-JUN-2003) to the INSDC.
RL   Bell Museum of Natural History and Department of Ecology, Evolution, and
RL   Behavior, University of Minnesota, 1987 Upper Buford Circle, St. Paul, MN
RL   55103, USA
XX
DR   MD5; e3ee5dcfe3c1b314d92748bf030756cd.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1176
FT                   /organism="Maxomys whiteheadi"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="UMMZ174492"
FT                   /db_xref="taxon:69127"
FT   gene            <1..>1176
FT                   /gene="IRBP"
FT   mRNA            <1..>1176
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT   CDS             <1..>1176
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="GOA:Q6VUM8"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6VUM8"
FT                   /protein_id="AAQ94656.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPGALEAPQQAPALTNLTXEELLAQIQRNIHHEVLEGNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWKQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVLHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLAXMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETSSRPEIGPNDPPAVTPEVPKEEAARRALVDSVFQVSVLPGN"
XX
SQ   Sequence 1176 BP; 249 A; 341 C; 346 G; 232 T; 8 other;
     ctgatgggaa tgcaagccgc cattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcagaccccc agacgctggc ccatgtgctg acagctggag tacagagctc tttgaatgac       120
     ccacgtctct tcatctccta tgagcccggt gccctcgagg ctccccagca agcaccagca       180
     ctcaccaacc tcacccraga agaactgctg gcccagatac agaggaacat ccaccatgag       240
     gttcttgagg gcaacgtggg ctacctacga gtggatgatc tccctggcca ggaggtactg       300
     agtgagctgg gggagttcct agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttggtgctgg atctccggca ctgtgcyggt ggccatgtct ctgggatccc gtatgtcatc       420
     tcctacctgc accctgggaa cactgtcttg cacgtggata ccatctatga tcggccctcc       480
     aacaccacca cagagatctg gaccttgcct aaggtcctrg gggagagata cagtgctgac       540
     aaggaygtgg tggtcctcac cagtggacat accggaggag tggctgagga catcgcctac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggacagaggg tggcgccctg       660
     gacctccaga aactgagaat aggtcagtcc aacttcttcc tcacrgtgcc cgtgtccagg       720
     tccctagggc ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggatac ctgcagagca ggccctagaa aaggccctgg ccatccttac cctgcgtcga       840
     gccctgccag gggtcgtcct ccgacttcag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc crggcctgct gcaccacctg gcyrgcatgg actactcggc cgtggtctct       960
     gaagaggacc tggtgacaaa gcttaatgct ggtttgcagg ctgtgtcaga ggatcctagg      1020
     ctcctggtga gagccactgg acccagagaa acctcctcaa gacctgagat tggacctaat      1080
     gaccccccag cagtcacccc tgaggtgccc aaggaagaag ctgcccggag ggccctagtg      1140
     gactctgtgt ttcaggtgtc cgtgctgcca ggcaat                                1176
//


spacer
spacer