spacer

EBI Dbfetch

ID   AY326091; SV 1; linear; genomic DNA; STD; ROD; 1233 BP.
XX
AC   AY326091;
XX
DT   01-JAN-2004 (Rel. 78, Created)
DT   11-MAR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Lophuromys flavopunctatus interphotoreceptor retinoid-binding protein
DE   (IRBP) gene, partial cds.
XX
KW   .
XX
OS   Lophuromys flavopunctatus (yellow-spotted brush-furred rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Deomyinae; Lophuromys.
XX
RN   [1]
RP   1-1233
RX   DOI; 10.1016/j.ympev.2003.07.002.
RX   PUBMED; 15019624.
RA   Jansa S.A., Weksler M.;
RT   "Phylogeny of muroid rodents: relationships within and among major lineages
RT   as determined by IRBP gene sequences";
RL   Mol. Phylogenet. Evol. 31(1):256-276(2004).
XX
RN   [2]
RP   1-1233
RA   Jansa S.A., Weksler M.;
RT   ;
RL   Submitted (19-JUN-2003) to the INSDC.
RL   Bell Museum of Natural History and Department of Ecology, Evolution, and
RL   Behavior, University of Minnesota, 1987 Upper Buford Circle, St. Paul, MN
RL   55103, USA
XX
DR   MD5; 98b3e1f39a2d356176a6a7dd0e3ee2eb.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1233
FT                   /organism="Lophuromys flavopunctatus"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="FMNH155575"
FT                   /db_xref="taxon:51348"
FT   gene            <1..>1233
FT                   /gene="IRBP"
FT   mRNA            <1..>1233
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT   CDS             <1..>1233
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="GOA:Q6VUN1"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6VUN1"
FT                   /protein_id="AAQ94653.1"
FT                   /translation="LMGMQAAIEQAMKSREILGISDPQTLAHVLTAGVQSSLNDPRLLI
FT                   SYEPSXLEAPQQVPELTNLTQEDLLAQIQRNIRQDVLEDNVGYLRVDDLPGQEVLRELE
FT                   EFLVTHVWKQLINTSSLVLDLRHCAGGHVSGIPYVISYLYPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPQVLGERYSTDKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHQLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRAAGPRETSCRPETGPNDSPAAVPELPEEDAARRSLVDSVFQVSVLPGNVGYLRFD
FT                   GFADTRVLRTLG"
XX
SQ   Sequence 1233 BP; 268 A; 346 C; 367 G; 251 T; 1 other;
     ttgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcgtgagat tctgggcatc        60
     tcagaccctc agacgctggc ccacgtgctg acagctggag tgcagagttc cttgaatgac       120
     ccacgtctcc tcatctccta tgagcccagt aycctggagg ctccccagca agtaccagaa       180
     ctcaccaacc tcacccaaga agacctgctg gcccagatac agagaaacat ccgccaggac       240
     gttcttgagg acaatgtggg ctacctacga gtggatgacc tcccaggcca agaggtgctg       300
     agggagctgg aggagttctt ggtgacccat gtgtggaagc agctcataaa tacctcctct       360
     ttggtgctgg atctccggca ctgcgcaggt ggtcatgtct ctgggatccc ttatgtcatc       420
     tcctacttgt accccgggaa caccgtcatg cacgtagata ccatctacga tcgcccctct       480
     aataccacga cggagatctg gaccttgccc caggtcctgg gggaaagata cagcactgac       540
     aaggatgtgg tggtcctgac cagtggacgt actgggggag tggctgagga catcgcctac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgaga ggacagaggg tggtgctctg       660
     gacctccaga aactgagaat aggccagtct aacttcttcc tcacagtacc cgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acgtgggaag gtagtggagt actgccctgt       780
     gtggggacac ctgcagagca ggccctggaa aaggcgctgg ccatccttac cctgcgtcgt       840
     gccctgccag gggttgtcct ccggcttcag gaagccctgc aggactatta cacactggtg       900
     gaccgagtgc caggcctact acaccagctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggacc tagtgacaaa gctcaacgct ggcttgcagg ctgtgtcgga ggaccccagg      1020
     ctcctggtaa gagccgctgg accaagagaa acctcatgca ggcctgagac tgggcctaat      1080
     gattctccag cagcagtccc tgagttgcct gaggaagacg ctgcccgcag gtccctagtg      1140
     gactctgtgt ttcaggtatc cgtactgcca ggcaatgtgg gctacctgcg ctttgacgga      1200
     tttgcagata cccgggtgct gaggacactg ggc                                   1233
//


spacer
spacer