spacer

EBI Dbfetch

ID   AY326084; SV 1; linear; genomic DNA; STD; ROD; 1128 BP.
XX
AC   AY326084;
XX
DT   01-JAN-2004 (Rel. 78, Created)
DT   11-MAR-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Deomys ferrugineus interphotoreceptor retinoid-binding protein (IRBP) gene,
DE   partial cds.
XX
KW   .
XX
OS   Deomys ferrugineus (Congo forest mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Deomyinae; Deomys.
XX
RN   [1]
RP   1-1128
RX   DOI; 10.1016/j.ympev.2003.07.002.
RX   PUBMED; 15019624.
RA   Jansa S.A., Weksler M.;
RT   "Phylogeny of muroid rodents: relationships within and among major lineages
RT   as determined by IRBP gene sequences";
RL   Mol. Phylogenet. Evol. 31(1):256-276(2004).
XX
RN   [2]
RP   1-1128
RA   Jansa S.A., Weksler M.;
RT   ;
RL   Submitted (19-JUN-2003) to the INSDC.
RL   Bell Museum of Natural History and Department of Ecology, Evolution, and
RL   Behavior, University of Minnesota, 1987 Upper Buford Circle, St. Paul, MN
RL   55103, USA
XX
DR   MD5; f56fa4d3da1a645b84c9b50425a92886.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1128
FT                   /organism="Deomys ferrugineus"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="AMNH269864"
FT                   /db_xref="taxon:106343"
FT   gene            <1..>1128
FT                   /gene="IRBP"
FT   mRNA            <1..>1128
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT   CDS             <1..>1128
FT                   /codon_start=2
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="GOA:Q6VUN8"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="UniProtKB/TrEMBL:Q6VUN8"
FT                   /protein_id="AAQ94646.1"
FT                   /translation="AMKSREILGISDPQTLAHVLTAGVQSSLNDPRLLISYEPSTLEAP
FT                   QQVPELTNLTREDLLAQIQRNIHHEVLEGNVGYLRVDDLPGQEVLSELGEFLVTHVWKQ
FT                   LMGTSSLVLDLRHCTGGHVSGIPYVVSYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVL
FT                   GERYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNF
FT                   FLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQE
FT                   ALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVMKLNAGLQTVSEDPRLLVRATGPRE
FT                   TSCRPETGPNDSPAAVPEVPEEEAARRSLVDSVFQV"
XX
SQ   Sequence 1128 BP; 241 A; 322 C; 338 G; 227 T; 0 other;
     ggcgatgaag agtcgtgaga ttctgggcat ctcggaccct cagacgctgg cccacgtgct        60
     gacagctgga gtacagagtt ccttaaatga cccacgcctc ctcatctcct atgagcccag       120
     taccctggag gctccccagc aagtaccaga actcaccaac ctcacccgag aagacctgct       180
     ggcccagata cagaggaaca tccaccatga ggttcttgag ggcaacgtgg gttacctacg       240
     agtggatgac ctcccaggcc aagaggtgct gagtgagctg ggggagttct tggtgaccca       300
     tgtgtggaag cagctcatgg gtacctcctc tttggtgcta gatctccggc attgcacagg       360
     tggtcatgtc tctgggattc cttatgtcgt ctcctactta caccctggga acactgtcat       420
     gcacgtagac accatctatg atcgcccctc caataccacc acagagatct ggaccttgcc       480
     caaggtcctg ggggagagat acagtgctga caaggatgtg gtggtcctca ccagtggacg       540
     tacgggggga gtggctgagg acatagccta catcctcaag cagatgcgca gggccatcgt       600
     agtgggtgag aggacagagg gtggtgccct ggacctccag aagctgagaa taggccagtc       660
     caacttcttc ctcacagtgc ccgtgtccag atccctggga cccctaggtg gaggtggcca       720
     gacatgggaa ggcagtggag tgctgccctg cgtggggacg cctgcagagc aggccctgga       780
     aaaggccctg gccatcctca ccctgcgtcg tgccctgccg ggggttgtcc tgcggcttca       840
     ggaagccctg caggactatt acacactggt ggaccgagtg ccaggcctac tacaccacct       900
     ggctagcatg gactactcag ctgtggtctc cgaagaggac ctagtgatga agctcaatgc       960
     tggcttgcag actgtgtcgg aggaccccag gctcctggta agggccactg gacccagaga      1020
     aacctcctgt aggcctgaga ctggacctaa tgattctcca gcagctgtcc ctgaggtgcc      1080
     cgaggaagaa gctgccagga ggtccctagt ggactctgtg tttcaggt                   1128
//


spacer
spacer