spacer

EBI Dbfetch

ID   AY324467; SV 1; linear; genomic DNA; STD; ROD; 1144 BP.
XX
AC   AY324467;
XX
DT   22-JUL-2003 (Rel. 76, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 5)
XX
DE   Apomys hylocoetes voucher FMNH 147871 cytochrome b (cytb) gene, complete
DE   cds; mitochondrial.
XX
KW   .
XX
OS   Apomys hylocoetes (Mindanao mossy forest mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   "Molecular phylogeny of the endemic Philippine rodent Apomys (Muridae) and
RT   the dynamics of diversification in an oceanic archipelago";
RL   Biol. J. Linn. Soc. Lond. 80(4):699-715(2003).
XX
RN   [2]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   ;
RL   Submitted (18-JUN-2003) to the INSDC.
RL   Department of Biological Science, Florida State University, Tallahassee, FL
RL   32306-1100, USA
XX
DR   MD5; d8e9bb93763ac120ed55f494b5d10162.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1144
FT                   /organism="Apomys hylocoetes"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Philippines:Mindano Is. Bukidnon Prov., Mt
FT                   Katanglad Range, 16.5km S, 4km E Camp Phillips"
FT                   /specimen_voucher="FMNH 147871"
FT                   /db_xref="taxon:238004"
FT   gene            1..1144
FT                   /gene="cytb"
FT   CDS             1..1144
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:1144,aa:TERM)
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /note="TAA stop codon is probably completed by the addition
FT                   of 3' A residues to the mRNA"
FT                   /db_xref="GOA:Q7Y779"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y779"
FT                   /protein_id="AAP88712.2"
FT                   /translation="MTNIRKTHPLIKIINHSFIDLPAPSNISSWWNFGSLLGLCLIIQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFIHIGRGIYY
FT                   GSYTFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLDSDADKIPFHP
FT                   YYTIKDLLGVFLLILFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFMPFLHTSKQRSLMFRPITQVLYWMLVANLLVLTWIGG
FT                   QPVEHPFVIIGQLASISYFSIILILMPISGIIEDKLLKWSL"
XX
SQ   Sequence 1144 BP; 353 A; 330 C; 142 G; 319 T; 0 other;
     atgacaaaca tccgaaaaac acatcccctt attaaaatta tcaatcactc ctttattgac        60
     cttccagccc catccaacat ctcatcctga tgaaacttcg gttcccttct aggactatgc       120
     ctaattatcc aaatcatcac aggactattc ctagccatac attacacatc agacacaact       180
     accgccttct catcagtaac ccacatctgc cgagatgtga actatggctg acttattcgc       240
     tacatacatg caaacggagc ttctatattt ttcatctgcc tgttcattca catcggacga       300
     ggaatctact acggatctta cacttttata gaaacatgaa acatcggggt aattctccta       360
     tttgccgtta tagccactgc attcataggc tacgtccttc catgaggaca aatatcattc       420
     tgaggagcaa cagtaattac aaatctactg tccgctatcc catatatcgg cacaacctta       480
     gttgaatgaa tttgaggcgg attctcagtt gataaagcca cactaacccg attcttcgca       540
     ttccatttta ttcttccatt catcatcgca gccctagtca tcgtccacct tctattcctc       600
     cacgaaacag gctctaacaa cccaacaggc ttagactctg acgctgacaa aatcccattt       660
     cacccatact acacaattaa agacttacta ggagtattcc tactaatcct atttcttata       720
     accctagtac tattcttccc agacctatta ggagacccag ataattacac accagcaaat       780
     ccactaaata caccacccca tattaaacca gaatgatact tcctattcgc ctacgcaatc       840
     ctacgttcaa tccccaacaa actgggaggt gtactggctc taatcttatc aatcttaatc       900
     ctagcattta taccattcct tcacacctca aaacaacgaa gcctaatatt ccgccctatc       960
     acccaagtac tttattgaat gctagtagcc aacctactag tcctaacctg aatcggagga      1020
     caaccagtag aacacccatt cgttatcatc ggccaactag cctcaatcag ctacttctcc      1080
     atcattctca tccttatacc aatctcagga attatcgaag acaaactact aaaatgaagt      1140
     ctat                                                                   1144
//


spacer
spacer