spacer

EBI Dbfetch

ID   AY324461; SV 1; linear; genomic DNA; STD; ROD; 1144 BP.
XX
AC   AY324461;
XX
DT   22-JUL-2003 (Rel. 76, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 5)
XX
DE   Chrotomys gonzalesi voucher USNM 458952 cytochrome b (cytb) gene, complete
DE   cds; mitochondrial.
XX
KW   .
XX
OS   Chrotomys gonzalesi (Isarog striped shrew-rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Chrotomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   "Molecular phylogeny of the endemic Philippine rodent Apomys (Muridae) and
RT   the dynamics of diversification in an oceanic archipelago";
RL   Biol. J. Linn. Soc. Lond. 80(4):699-715(2003).
XX
RN   [2]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   ;
RL   Submitted (18-JUN-2003) to the INSDC.
RL   Department of Biological Science, Florida State University, Tallahassee, FL
RL   32306-1100, USA
XX
DR   MD5; 70c45c26a8e6247d4251f08b746c7c15.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1144
FT                   /organism="Chrotomys gonzalesi"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Philippines:Luzon Is. Camarines Sur Prov., Mt.
FT                   Isarog, 1350 m"
FT                   /specimen_voucher="USNM 458952"
FT                   /db_xref="taxon:237998"
FT   gene            1..1144
FT                   /gene="cytb"
FT   CDS             1..1144
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:1144,aa:TERM)
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /note="TAA stop codon is probably completed by the addition
FT                   of 3' A residues to the mRNA"
FT                   /db_xref="GOA:Q7YC75"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YC75"
FT                   /protein_id="AAP88706.2"
FT                   /translation="MTNIRKTHPLIKIINHSFIDLPAPSNISSWWNFGSLLGLCLMIQI
FT                   ITGLFLAMHYTSDTTTAFSSVAHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFMETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDLLGALILILSLMTMVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFLPFLHTSKQRSMMFRPITQVLYWLLVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKLLKWSL"
XX
SQ   Sequence 1144 BP; 369 A; 297 C; 141 G; 337 T; 0 other;
     atgacaaaca tccgaaaaac acaccccctt attaaaatta ttaatcactc ctttattgac        60
     ctcccagccc catcaaacat ttcatcatga tggaactttg gctctctact agggttatgc       120
     cttataatcc aaatcatcac aggacttttc ctagctatac attacacatc agatacaaca       180
     acagcatttt catcagtagc ccacatttgc cgagacgtaa actatggctg acttattcgt       240
     tacatacacg caaacggagc ttcaatattt ttcatctgct tatttcttca cgtaggacga       300
     ggaatatatt atgggtctta cacttttata gaaacatgaa acattggagt aatcctccta       360
     ttcactgtaa tagctacagc attcataggc tatgtacttc catgaggcca aatatcattc       420
     tgaggtgcaa ccgtaattac aaacctatta tcagccatcc cctatattgg aacgacctta       480
     gtagaatgaa tctgaggcgg attttctgtc gataaagcca ccttaacccg attcttcgca       540
     ttccacttta ttctaccatt tatcattaca gcactagtta ttgtccactt attatttctt       600
     cacgaaacag gatccaataa cccaacaggt ctaaactcag acgctgacaa aattccattc       660
     cacccatatt atacaatcaa agacctgctt ggagcactta tcctaatcct atccctaata       720
     accatagtat tattctttcc agatttatta ggcgacccag acaattatac acccgcaaat       780
     ccactaaata caccacccca cattaaacca gagtgatatt tcctattcgc ctacgctatt       840
     ctacgctcaa tcccaaataa attaggaggt gtattagcac taatcctatc tatccttatc       900
     ctagcattct taccattcct tcatacatca aaacaacgaa gcataatatt ccgcccaatc       960
     acccaagtac tatactgact actagtagcc aacctactag tactaacctg aatcggaggc      1020
     caaccagtag aacacccatt tatcattatt ggacaattag cctcaatcag ctatttctca      1080
     atcatcctaa ttcttatacc aatctcgggg atcattgaag acaaactatt aaaatgaagc      1140
     ctat                                                                   1144
//


spacer
spacer