spacer

EBI Dbfetch

ID   AY324460; SV 1; linear; genomic DNA; STD; ROD; 1144 BP.
XX
AC   AY324460;
XX
DT   22-JUL-2003 (Rel. 76, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 5)
XX
DE   Archboldomys luzonensis voucher EAR 4098 cytochrome b (cytb) gene, complete
DE   cds; mitochondrial.
XX
KW   .
XX
OS   Archboldomys luzonensis (Isarog shrew-mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Archboldomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   "Molecular phylogeny of the endemic Philippine rodent Apomys (Muridae) and
RT   the dynamics of diversification in an oceanic archipelago";
RL   Biol. J. Linn. Soc. Lond. 80(4):699-715(2003).
XX
RN   [2]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   ;
RL   Submitted (18-JUN-2003) to the INSDC.
RL   Department of Biological Science, Florida State University, Tallahassee, FL
RL   32306-1100, USA
XX
DR   MD5; 97ab7fdbde64243aaf4f7a796f30461c.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1144
FT                   /organism="Archboldomys luzonensis"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Philippines:Luzon Is. Camarines Sur Prov., Mt.
FT                   Isarog, 1350 m"
FT                   /specimen_voucher="EAR 4098"
FT                   /db_xref="taxon:237995"
FT   gene            1..1144
FT                   /gene="cytb"
FT   CDS             1..1144
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /transl_except=(pos:1144,aa:TERM)
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /note="TAA stop codon is probably completed by the addition
FT                   of 3' A residues to the mRNA"
FT                   /db_xref="GOA:Q7YC76"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YC76"
FT                   /protein_id="AAP88705.2"
FT                   /translation="MTNIRKTHPLIKIINHSFIDLPTPSNISSWWNFGSLLGLCLIIQI
FT                   MTGLFLSMHYTSDTTTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFMETWNIGVLLLFTIMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDLLGVFILILSLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLIFRPITQTLYWMLVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKLLKWSL"
XX
SQ   Sequence 1144 BP; 368 A; 305 C; 133 G; 338 T; 0 other;
     atgacaaaca tccgaaaaac acatcctctt atcaaaatca tcaaccactc cttcatcgac        60
     cttcccaccc catccaacat ctcatcatga tggaactttg gctccctgct aggactatgt       120
     ctcattattc aaatcataac aggattattc ctatccatac attatacatc agacacaaca       180
     acagcattct catcagtaac tcatatttgc cgagacgtca actatggctg acttatccgt       240
     tatctacatg caaacggagc ctcaatattc tttatctgct tatttctcca tgtaggacga       300
     ggaatatact atggatccta tacctttata gaaacatgaa acattggagt acttctccta       360
     ttcaccatta tagctactgc attcataggc tatgttctcc catgaggaca aatatcattc       420
     tgaggagcaa ccgtaattac aaacttacta tcagctattc catacatcgg aacaacccta       480
     gtagaatgaa tctgaggagg gttctcagtt gataaagcca ctctaacacg attttttgca       540
     ttccacttca tcctgccatt cattatcaca gctctagtca tcgtccacct actatttctc       600
     catgaaacag gctcaaacaa tcctaccggc ctaaactcag atgctgataa aattccattt       660
     cacccatatt atacaatcaa agacctacta ggagtcttta tcttaatcct atccctaata       720
     accctagtac tatttttccc agacttacta ggagaccctg acaactatac accagctaac       780
     ccattaaata caccacccca tattaaacca gaatgatact ttttatttgc ctacgccatt       840
     ctacgctcaa tcccaaacaa actaggagga gttctagccc taatcctatc aattcttatc       900
     ctagcattat tacctttcct ccatacatcc aaacaacgaa gcctaatttt ccgaccaatt       960
     actcaaacac tctattgaat actagtagcc aatctactag tactaacctg aattggaggt      1020
     caaccagtag aacatccatt cattattatc ggacaattag cctcaattag ctacttctct      1080
     atcatcctta ttctaatacc aatctcagga atcattgaag acaagctatt aaaatgaagt      1140
     ttat                                                                   1144
//


spacer
spacer