spacer

EBI Dbfetch

ID   AY324459; SV 1; linear; genomic DNA; STD; ROD; 1144 BP.
XX
AC   AY324459;
XX
DT   22-JUL-2003 (Rel. 76, Created)
DT   03-JUN-2010 (Rel. 105, Last updated, Version 4)
XX
DE   Batomys granti voucher USNM 458948 cytochrome b (cytb) gene, complete cds;
DE   mitochondrial.
XX
KW   .
XX
OS   Batomys granti
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Batomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   "Molecular phylogeny of the endemic Philippine rodent Apomys (Muridae) and
RT   the dynamics of diversification in an oceanic archipelago";
RL   Biol. J. Linn. Soc. Lond. 80(4):699-715(2003).
XX
RN   [2]
RP   1-1144
RA   Steppan S.J., Zawadzki C., Heaney L.R.;
RT   ;
RL   Submitted (18-JUN-2003) to the INSDC.
RL   Department of Biological Science, Florida State University, Tallahassee, FL
RL   32306-1100, USA
XX
DR   MD5; 1cad64f13fbdb1a987e92b468fde34f7.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1144
FT                   /organism="Batomys granti"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Philippines:Luzon Is., Camarines Sur Prov., Mt.
FT                   Isarog, 1750 m."
FT                   /specimen_voucher="USNM 458948"
FT                   /db_xref="taxon:234628"
FT   gene            1..1143
FT                   /gene="cytb"
FT   CDS             1..1143
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q7YC77"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YC77"
FT                   /protein_id="AAP88704.1"
FT                   /translation="MTNFRKTHPLFKIINNSFIDLPAPSNISSWWNFGSLLGICLVLQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGIYY
FT                   GSYTFIETWNIGIVLLFMVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGSSLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTMKDLLGILMMLLSLMILVLFFPDILGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALMPLLHTSKQRSLMFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIMIGQLASISYFSIILILMPISGIIEDKMLKLT"
XX
SQ   Sequence 1144 BP; 381 A; 309 C; 134 G; 320 T; 0 other;
     atgacaaact tccgaaaaac ccacccacta ttcaaaatca ttaataactc attcatcgat        60
     ctacctgcac catccaacat ctcatcatga tgaaacttcg gatcactact gggaatctgt       120
     ttagtattac aaatcatcac aggcttattc ctagctatac attatacatc agatacaaca       180
     acagcattct catcagtaac tcacatttgc cgagacgtaa actacggatg actaatccgc       240
     tatatacacg caaacggagc ctccatattc ttcatctgcc tattccttca cgtaggacga       300
     ggtatttact atggatcata tacattcatc gaaacctgaa acattggaat tgtactccta       360
     tttatagtta tagccaccgc attcatagga tatgtactcc catggggaca aatatcattc       420
     tgaggggcta cagtaatcac aaatctacta tcagcaatcc catacatcgg atcatcactg       480
     gtagaatgaa tctgaggagg tttctcagta gacaaagcca ccctaacacg cttcttcgct       540
     tttcacttca ttctaccatt tattatcaca gccctcgtaa ttgtacactt actatttcta       600
     cacgaaacag gatcaaacaa tccaacagga cttaactcag actcagataa aattccattt       660
     catccatact atacaataaa agacctatta ggaatcctta taatacttct atcactcata       720
     attctagtac tatttttccc agacatttta ggagacccag acaattacac accagccaac       780
     ccactaaaca ccccaccaca tatcaaacca gaatgatact tcttattcgc ctacgctatc       840
     ctacgttcaa ttccaaacaa actaggtgga gtattagccc taatcctgtc tatcttaatc       900
     ttagccctaa tacctctcct tcacacctca aaacaacgta gcctcatatt ccgcccaatc       960
     acacaaaccc tttactgaat cctagtagct aatcttctaa ttctaacctg aatcggagga      1020
     cagccagtag agcacccatt tattataatc ggacaattag cctcaatcag ttacttctcc      1080
     attatcctca ttctaatacc catctcagga atcatcgaag acaaaatact caaactaaca      1140
     taaa                                                                   1144
//


spacer
spacer